KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00528Help
Entry
Thethe_00528      CDS       T02407                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00473  D-Alanine metabolism
tto01100  Metabolic pathways
tto01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thethe_00528
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Thethe_00528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tto01011]
    Thethe_00528
Enzymes [BR:tto01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Thethe_00528
Peptidoglycan biosynthesis and degradation proteins [BR:tto01011]
 Precursor biosynthesis
  Racemase
   Thethe_00528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TH1
Motif
Other DBs
NCBI-ProteinID: AGB18224
UniProt: L0IHI1
LinkDB All DBs
Position
506187..507353
Genome map
AA seq 388 aa AA seqDB search
MLNLYRPTWAEVDLNNIIHNYKEIRKITDKKAGIMAVVKANAYGHGSYEVSKELINCGVD
YLAVATIDEALELREQGISKPILILGYTPAKFADVIVKYDITQTAFELSYVKEVAKVAQK
LGKDAKIHVKVDTGMGRIGYNDMNKAYEEILSMSSLAGINIEGIFSHFSSSDEKDKEYTI
RQLKIFLSLIERLKKSGIYIPIRHIANSAAILDMPETHLDMVRPGIILYGSFPSDEVNKK
IDLRPTISLRSKVVYVKDVEEGEYISYNRTYRTNRKSRIATLPIGYADGLNRLLSNNHNV
IINGKYAPIVGKICMDQCMVDVTSIEDVKEGDTATIMGEADGKFISADEIADKLKTIPYE
VYCGISRRVPRIYIFNGEITKVENYLKC
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacttatataggccaacatgggcagaagttgatcttaataatataattcacaac
tacaaagagatcagaaaaataacagataaaaaggctgggataatggctgttgtaaaagca
aatgcgtatgggcacggttcgtatgaagtgtcgaaggaattgataaattgtggtgtggat
tatctggctgttgcaacaatagacgaggctttggaattaagagagcagggtatatcaaag
ccaatactcattttaggatatactccagcaaagtttgctgatgtaattgtaaagtacgat
attacgcaaacagcatttgagctaagttacgtaaaagaggtagcaaaggtggctcaaaaa
cttggcaaagatgctaagattcatgttaaggtagatacgggaatgggacgcattggctac
aatgacatgaataaagcttatgaagaaattttatccatgtcatctcttgctggaatcaac
attgaaggcatatttagccatttttcgtcatcagacgaaaaagacaaggagtacacgata
aggcagcttaagatttttttaagccttatagaaaggcttaaaaagtctggtatatacatt
cctattaggcacatagcaaacagtgctgcaatattagacatgcctgaaacacaccttgac
atggtaagacctgggattatactttatggcagttttccttcagatgaagtcaataagaaa
atcgatttaaggccgaccatatctttaaggtcgaaagtcgtctatgttaaagatgtagaa
gaaggtgaatatataagctacaacaggacatataggacaaacagaaaaagtcgcatagcc
actttgcctatagggtatgcggatggtttaaacaggcttttatcaaataatcacaatgtc
ataataaatggcaaatacgctcctatagtaggtaaaatatgcatggatcaatgcatggtt
gatgtgacgtcgattgaagatgttaaagaaggcgatacagccactattatgggagaagca
gatggcaaattcataagcgctgatgaaattgcagataaattaaaaactatcccttatgaa
gtatattgtggaatatccagacgggtaccaagaatatatatatttaatggagagataaca
aaagtagaaaattatttaaaatgttaa

DBGET integrated database retrieval system