KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00751Help
Entry
Thethe_00751      CDS       T02407                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00500  Starch and sucrose metabolism
tto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thethe_00751
Enzymes [BR:tto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Thethe_00751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 TPR_8
Motif
Other DBs
NCBI-ProteinID: AGB18438
UniProt: L0IHX5
LinkDB All DBs
Structure
PDB: 

Position
750699..752807
Genome map
AA seq 702 aa AA seqDB search
MSRKLIKYLPLLMLASSVLSGCFNNVSSIKIDRFINISAVNGPGEEDTWASAQKQGVGTA
NNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVSDETNDTISKVEKFTDK
SLGYKLVNTDKKGRYRITKEIFTDVKRNSLIMKAKFEALEGSINDYKLYLAYDPHIKNQG
SYNEGYVIKANNNEMLMAKRDNIYTALSSNIGWKGYSIGYYKVNDIMTNLDENKQMTKHY
DSARGNIIEGAEIDLTKNSEFEIVLSFGGSDSEAAKTALETLGEDYNNLKNNYIDEWTKY
CNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQSDDNTGGYHLVWSR
DLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGVIPQNTWISGKPYWTGIQLDEQADPII
LSYRLKRYDLYDSLVKPLADFIIKMGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAE
QNKDYESAQKYQEKADNWQKLIDNLTYTENGPLENGQYYIRIAGLPDPNADFTISIANGG
GMYDQKEIVDPSFLELVRLGVKSAEDPKILNTLRVVDSTIKVDTPKGPSWYRYNHDGYGE
PSKEELYHGVGKGRLWPLLTGERGMYEIAAGKDATPYLKAMENFANEGGIISEQVWEDTG
LPTDSASPLNWAHAEYVVLFASNIEHKVLDMPDIVYKRYVSK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggaaacttattaaatatttacctttactaatgttagcatcaagtgttttaagc
ggatgtttcaacaatgtgtcaagtatcaaaatagatagatttattaatattagcgcagta
aatggacctggtgaagaagatacatgggctagcgctcaaaaacagggtgtcggtacagca
aataattatgtatcaaaagtttggtttacgctggcaaatggcgctatatcagaggtgtac
tatccaacgatagatacagcagatgtaaaagaaattaaatttattgtcactgatgggaaa
tcgtttgtctcagatgaaacaaacgatacaataagcaaggtggagaagtttaccgataag
tcattaggttataagctagtcaatacagataaaaaaggaaggtatagaataacaaaagaa
atatttacagatgtaaaacgcaattctctgataatgaaggcaaagtttgaagcattagaa
ggaagcataaatgactataagctgtatcttgcatacgacccacatattaaaaatcagggg
agttacaatgaaggttatgtaataaaggctaataacaatgagatgctgatggcaaaaaga
gataacatatatactgctttatcatctaacataggttggaaaggatattcgattgggtat
tataaagttaatgatattatgactaaccttgacgagaataagcaaatgactaagcattac
gatagcgcaaggggcaatatcatagaaggggcagagattgatttaacgaaaaacagcgaa
tttgaaatcgttctgtcatttggtggaagcgatagtgaagcagcaaaaacggcgttagag
actcttggggaagattataacaatttaaaaaataactatatagatgaatggactaaatat
tgcaatactctcaataatttcaatggcaaagcaaattcactctattacaacagcatgatg
atattaaaagcaagtgaagataagacaaataaaggtgcatacattgcatcactttcgatt
ccttggggggatggacaaagtgatgacaatacaggtggctatcatcttgtatggtcaagg
gatttgtaccatgtagcgaatgctttcattgcggctggagatgttgattctgccaataga
tcgctggattaccttgccaaagtggttaaggacaatggggtgattcctcaaaatacttgg
attagtggtaaaccgtattggacaggcattcagcttgatgagcaggcagatccaatcata
ctcagctataggctaaaaagatacgatctatatgatagtttagttaagccattggcagat
ttcataataaaaatggggcctaagacaggccaagaaaggtgggaagagataggtggatac
tcgcctgcaacaatggctgcagaggtagcaggacttacatgtgcagcgtatatagctgag
caaaataaagattatgaatccgcacaaaaatatcaagaaaaagcagacaactggcagaag
cttatcgataatctcacttatactgaaaatggaccactagaaaatggccaatactatatt
agaatagctggattacctgatccaaatgcggattttacgataagcatagcaaatggcgga
ggaatgtacgatcaaaaagaaatagtagacccaagttttctggagcttgtaaggcttgga
gttaaatcggcagaggatcctaaaatattaaatacgttaagagttgttgatagcacaatt
aaagttgacacaccaaagggaccgtcgtggtacagatataatcatgatgggtacggtgaa
ccatcaaaggaagaactatatcacggcgtaggaaagggaagattgtggcctcttcttact
ggtgagagaggcatgtacgaaattgccgcaggaaaagatgcgacaccgtatttaaaagca
atggagaattttgcaaacgaaggtggcataatatctgagcaggtttgggaggataccggt
cttccaactgattccgcatcacctcttaattgggcacatgcagaatacgtagtattattt
gcgtcaaatatagaacataaagtgcttgatatgccggatattgtttataaaaggtatgtt
tcaaagtaa

DBGET integrated database retrieval system