KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01486Help
Entry
Thethe_01486      CDS       T02407                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Brite
KEGG Orthology (KO) [BR:tto00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tto01001]
    Thethe_01486
Enzymes [BR:tto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Thethe_01486
Protein kinases [BR:tto01001]
 Serine/threonine kinases: Other
  Bacterial family
   Thethe_01486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like RIO1 Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AGB19127
UniProt: L0IMB8
LinkDB All DBs
Position
complement(1450280..1452187)
Genome map
AA seq 635 aa AA seqDB search
MIGRMLGNRYEILEKIGEGGMAKVYKAKCHLLNRIVAIKILRSEFVADEEFVRRFKRESQ
AAASLSHPNIVSIYDVGQEGDIYYIVMEYVNGKTLKQLIREANGPLPIPKALDITRQVCG
ALEHAHKNHIVHRDIKPQNILVTDDNIVKVTDFGIARAANGSTITYGGGDVLGTAYYFSP
EQAKGAMIDEKTDIYSLGIVMYEMLTGKVPFEGESPISVALKHIQENIVPPSKLNPKVPY
NLDKIVLKATEKDINYRYKSASDLLNDIETYINNPDKLVVTNGNDNNVTRVMKSEEINEK
LSGTKTLKKKKKSGKIFRNIGIALLILALMASLSYGTMYFLNNMAITNEVTVPNIKGQTL
DKATSILESNNLKLNITDSQYSDAPTNTILSQNPPAGETVKKGSTVNVVVSKGKQTSVVP
NVIGSEYRDAQLKIKNSGLNANLIWDYNDSYPNGYVYDQNPRQGVQVENNTIVDIYVSKG
PEMVTVPNLVNMSLDDATKALENVGLKVGNITTQPSDSVPDNFVIDQSIPQGTSIQKGKS
IDLIVSQSTQQQQQQQQSQLPPGYKTKEITIDLPNQEGPMKVDVYVIQDGNKTLQYSNTF
TSADSPITVPVSGKGNVIIEVDINGSIYKTMGAKF
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgataggtagaatgcttggcaaccgatatgagatattagaaaaaattggtgaaggtggt
atggcaaaggtttataaagctaaatgtcatcttttaaacagaatagttgccataaagatc
ttgcgctctgaatttgtagcagatgaagaatttgtaagaagatttaaaagagaatcacaa
gcggcagctagcctttcgcatcctaatatagtaagtatatatgatgtaggacaagaagga
gatatttattatattgtaatggagtatgtcaatggtaaaacattaaaacaactaataaga
gaagctaatggacctttgcctataccaaaagctcttgacataacaagacaagtttgtgga
gcattggaacatgctcataaaaatcatattgtccacagggatataaagccacagaatata
ctagtaacagatgacaatattgtgaaggttactgattttggaatagcaagggctgcaaat
ggttcaacaataacgtacggtggtggtgacgtacttggtacagcctattatttttcacct
gaacaagcgaaaggtgctatgatagatgaaaagactgatatatattcactgggtattgtt
atgtatgagatgcttacagggaaggttcctttcgaaggtgaaagcccaatttcagttgca
ttaaagcatatacaggaaaatattgtgccgccatctaaattaaatccaaaagtgccgtat
aacctcgataaaatagtattaaaggcgacagaaaaagatataaattatagatacaaaagc
gcgtccgacctattaaatgacattgagacatatataaataatcctgataaattagttgtg
acaaatggaaatgataataatgtaacgcgggtcatgaaatcagaagaaataaatgagaag
ctatcaggaacgaagactcttaaaaagaagaaaaagagtggcaaaatttttagaaatata
ggaattgcattgctgattctggcattaatggcatcactatcatatggaacgatgtatttt
ttgaataacatggcaataacaaatgaagtaacagtgcctaatataaaagggcaaacactc
gataaggcaacaagcattttagaaagcaataatttaaaattgaacataacagatagccag
tacagcgatgcaccaactaatacaattttatcacagaatccgccagctggcgaaacggta
aagaagggaagtacagtaaatgtagtggttagtaaaggcaaacagacatcagtcgtgcca
aatgttataggcagtgagtacagggatgcgcaattaaaaattaaaaatagcggtttaaat
gctaacttgatttgggattataatgacagctatccaaatggttatgtgtatgaccaaaat
ccaaggcaaggtgtacaagttgaaaacaatactattgttgatatttacgtaagcaaaggt
ccagaaatggtaacagtgcctaacctcgtaaatatgtcacttgatgatgcaacaaaagca
ttggaaaatgtcggtcttaaagttggtaatataacaacccagcctagcgatagtgtgcct
gacaactttgtaatagatcagagcattcctcaaggcaccagtatacaaaaaggcaaatct
atagatttaattgtaagccaatcaactcagcaacagcaacaacagcagcaatcacaatta
ccacctggttacaaaacaaaagaaattacaattgatttgcctaaccaagaaggacctatg
aaagttgatgtttatgtgatacaagatggcaataaaacattacaatattctaatactttt
acttctgctgatagtccaataacagttcctgttagtggcaaaggaaatgttattatagaa
gttgatataaatggcagtatatataagacaatgggggcgaaattttag

DBGET integrated database retrieval system