KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01929
Entry
Thethe_01929      CDS       T02407                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Brite
KEGG Orthology (KO) [BR:tto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Thethe_01929
Enzymes [BR:tto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     Thethe_01929
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AGB19538
UniProt: L0IL15
LinkDB
Structure
PDB: 
6S9V

Position
complement(1899658..1901124)
AA seq 488 aa
MALNNKVQLITYPDSLGGDLKTLNDVLEKYFSDVFGGIHILPPFPSSGDRGFAPITYSEI
EPKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKD
GKPVKGDIEKMFLRRTLPYSTFKIEETGEEEKVWTTFGKTDPSEQIDLDVNSHLVKEFLL
EVFRTFSNFGVNIVRLDAVGYVIKKIGTSCFFVEPEIYEFLDWAKGQAASYGIELLLEVH
SQFEIQYKLAERGFWIYDFILPFTVLYTLINKSNEMLYDYLKNRPINQFTMLDCHDGIPV
KPDLDGLIDTKKARDVVDICVQRGANLSLIYGDKYKSEDGFDVHQIGCTYYSALNCDDDA
YLAARAIQFFTPGIPQVYYVGLLAGVNDFEAVKKTKEGREINRHNYGLKEIEESVQKKAV
QRLLKLIRFRNEYEAFNGEFMVQDCQKDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINEN
GEEVKYLV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgcttaataataaagtacaattaataacttatccagactcattgggcggtgatcta
aaaactttaaacgatgtattggaaaaatatttttctgatgtatttggcggtattcacatt
ttgcctccttttccatcatccggtgatagagggtttgcacctataacatacagtgagata
gaacctaaatttggaacatggtacgacattaagaaaatggctgaaaattttgacattctt
ttggatttaatggttaatcatgtatccagaagatctatttattttcaggatttcttaaaa
aaaggtagaaaatcagaatacgctgatatgtttattacattagataaactttggaaggat
ggaaaacctgtcaaaggcgacatagaaaaaatgtttttgagaaggactttgccatattcc
acatttaaaatagaagaaacaggagaagaagaaaaagtctggaccacctttggcaagaca
gatccatcagaacaaattgatttggacgtcaactcacatttagtgaaagaatttttatta
gaagtttttaggacatttagcaattttggtgttaatatagtacgactcgatgcagtagga
tatgtaataaaaaaaattgggacaagctgtttttttgtcgaaccggagatatatgaattt
ttagactgggcaaaaggacaagcagcttcttacggaatagaactgcttttggaggtacat
tcgcaatttgaaatacaatataaattagcagagcgtggtttttggatttatgattttatt
ttgccatttactgttctttatactttaataaataaatcaaacgaaatgttgtatgattat
ctaaaaaatcgtcccattaatcaatttacaatgttggattgtcatgacggaattcctgta
aagcctgatttagatggacttattgatactaagaaggctagagatgtagtcgatatatgt
gtacaaagaggtgcgaatctaagcctaatatacggagataaatataaatcagaagatggc
tttgatgtgcatcaaattgggtgcacttattattctgcattaaattgtgatgatgacgca
tatttggcagccagagccattcaattctttacaccaggtataccacaagtctattacgta
ggccttttagctggagtaaatgactttgaagcagtaaaaaagactaaagaagggcgagag
ataaatagacacaactatggtttaaaagaaatagaggaatcagttcaaaaaaaggcagtt
cagagattgctaaaattgatcagattcagaaatgaatacgaggcatttaatggtgaattt
atggttcaggactgtcaaaaggatgaaatcaggcttacttggaaaaaagatgataaacgt
tgcagtctgtttattgatttgaagacatataagacaactattgattatataaacgagaac
ggtgaagaagtaaagtatttagtataa

DBGET integrated database retrieval system