KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_02165Help
Entry
Thethe_02165      CDS       T02407                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00970  Aminoacyl-tRNA biosynthesis
tto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tto00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thethe_02165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tto03029]
    Thethe_02165
Enzymes [BR:tto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Thethe_02165
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Thethe_02165
Mitochondrial biogenesis [BR:tto03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thethe_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey PhageMin_Tail DUF4030
Motif
Other DBs
NCBI-ProteinID: AGB19740
UniProt: L0IJQ0
LinkDB All DBs
Position
complement(2128019..2129449)
Genome map
AA seq 476 aa AA seqDB search
MNYEAVIGLEVHAELLTKTKIFCSCTTEFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV
KAGLALNCEISKFSKMDRKNYFYPDLPKAYQISQYDLPLCKNGYVEIETSDGVKKKIGLT
RIHIEEDAGKLMHENIDGSLVDYNRTGVPLIEIVSEPDMRTPEEAYLYLTKLKSVLEYSE
VSDCKMQEGSLRVDTNVSVRPVGSKEFGTKIELKNLNSFKAVQRALEYEIKRQIKLIENG
EKVVQETRRWNEQKGITESMRSKEEAHDYRYFPEPDLVPIIVSDEWKEEIRKSLPEMPEH
KKERFVSQYGIPEYDASVITSSKPLADFFEKCALEYSSAKTISNWIMGEMMRLLKETGKE
IDEVSIKPHQMASLLNLIDNGTITGSIAKTVFEEMFMTGKNPEEIVEEKGLKQLSNEDEL
REIAAKVIKDNPKSVEDYKNGKDKALGFLVGQMMKATKGKANPQLANKLLREELSK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgaagcggttataggtcttgaagtacatgctgagcttcttacaaagacgaag
attttttgcagttgtacaacggagtttggcggtgaacctaatacacatgtttgtcctgtg
tgcttaggactaccaggtactttgcctgttttaaataaaaaagtagtagagtatgccgta
aaggcaggacttgccttaaactgcgaaatatccaaatttagtaaaatggatagaaaaaat
tatttttatccagatttgccgaaagcgtatcagatttcacagtatgaccttcctttgtgc
aaaaacggatatgtggagattgagacatcagatggtgttaaaaagaaaatcgggttaaca
aggatacatattgaagaagatgcaggtaaattaatgcatgaaaacattgatggctcttta
gttgattacaacaggactggtgtcccacttatagagatagtgtctgagcctgatatgaga
acgccagaagaagcttatctttatttgacgaagcttaaaagcgttcttgagtattctgaa
gtatcagactgcaaaatgcaggaaggttctctcagagtcgatacaaatgtatcggtgcga
cctgtaggcagcaaagagtttggaacgaaaatcgagcttaaaaaccttaattcatttaaa
gctgttcaaagggcattggaatacgaaattaaaaggcagataaaactgattgagaatgga
gagaaggttgtgcaggaaactcgccgctggaacgagcagaaaggcattacagagtctatg
cgttcaaaagaagaagcacatgactataggtatttcccagaacctgatctcgtacctata
atagtatctgatgaatggaaagaagagataagaaaatcgcttccagaaatgcctgagcat
aagaaggaaaggtttgtttctcaatatggaattccagagtacgatgcatccgtaataaca
tcatcaaagccattggctgatttctttgaaaagtgcgctttggagtactcatcagcaaag
acgataagcaattggataatgggggaaatgatgaggcttctaaaggagactggaaaagaa
attgatgaggtttcaattaagccgcatcagatggcttctcttctaaatcttatagataat
ggcactattactggttcaatagctaagacagtgtttgaagaaatgtttatgacaggtaag
aatccagaagagatcgtagaagaaaaaggtttaaagcagctgagtaacgaagatgagttg
agagaaatagctgcaaaagtcataaaggacaatcctaagtctgttgaagattataaaaat
ggcaaagataaagcattagggtttcttgtagggcaaatgatgaaagctactaaaggcaaa
gcaaatccgcaactggcaaataaacttttgcgagaagaactttcaaaataa

DBGET integrated database retrieval system