KEGG   Thermochromatium tepidum: E6P07_03610
Entry
E6P07_03610       CDS       T06573                                 

Gene name
rlmKL
Definition
(GenBank) bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
ttp  Thermochromatium tepidum
Brite
KEGG Orthology (KO) [BR:ttp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ttp03009]
    E6P07_03610 (rlmKL)
Enzymes [BR:ttp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     E6P07_03610 (rlmKL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     E6P07_03610 (rlmKL)
Ribosome biogenesis [BR:ttp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    E6P07_03610 (rlmKL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 THUMP Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_15 Met_10
Other DBs
NCBI-ProteinID: QGU32154
LinkDB
Position
complement(793826..796033)
AA seq 735 aa
MSDHLFFASAPKHLGSLLAEELTRLGMAEATETRGGARFSGRIEDGYRACLWSRIANRIL
LPLAQVSLGGPDEIRDSALKIPWEEHLAPERTFAIQFDGQLEGVTHPHFAILQVKDAIAD
RFNRLYGRRPSVDPESPDLRIHLYGNCDTLAFSLDLSGESLHQRGYREAGFAAPLKENLA
AALLLRAGWPEIAAEGGSLIDPMCGSGTLVIEGALIAADIAPGLLRKRFGFHGWIQHDEL
AWQRLLAEARLRRTAGLKRLGALRGYDIDPNAIRASLHHLKRAGLAGLAHFECRELADCR
PGREEDEGLVIVNPPYGERLGANEDLGQLYARLGMLLRERFLGWRAAVLTANPELGKRLG
LRATRIHSLYNGPIECRLLSFQVEPRYFISHLPRPLPPAERSPGATMLANRLKKNLRALR
QWREREGIDCLRLYDADLPEYALAIDLYEGDRRFVHVQEYAAPPSIDPKQARRRLREALG
LIPEVLEVPCEQVFLKVRRPQKGRAQYERLAQTRRFHEVAEYGHRFLVNFEDYLDTGLFL
NHREVRRLIGALAAGKRFLNLFAYTGTATVYAAKGGAVSTTTVDLSRTYLNWAARNLELN
GIQGPNHRLIQADCLRWIESMFGRCRFDLIFLDPPSFSTSKRMQGTLDIQRDHVAIIQST
MRLLEPGGRLIFSNNLRRFRLDLEGLAPFEVSDISAQTLPRDFARNPRLHHCWVIQHPGP
PPHWMDRGDDEVRHA
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgtccgatcatctcttcttcgcctctgcccccaagcatctcggcagcctgctcgccgaa
gagctgacccgactcgggatggcggaggccaccgagacgcgcggcggtgcacgcttctcg
ggacgcatcgaggatggctaccgtgcctgtttgtggtcgcggatcgccaaccgcatcctg
ctgccgctcgctcaggtgtcgctcggcggtccggacgagatccgcgacagcgcgttaaag
atcccctgggaggagcatctggccccggagcgtaccttcgccattcagttcgatggccaa
ctcgagggcgtcacccacccgcatttcgccatcctccaggtcaaggacgccatcgccgat
cgcttcaaccggctctacggacggcgtccgagcgtcgatcccgagtctccggatctgcgc
atccatctctatggcaattgtgataccctcgccttcagcctggatctctcgggcgagtcg
ctgcatcagcgcggctatcgcgaggccggttttgctgcgccgctcaaggagaatctggcc
gccgcgctcctgctgcgcgccggttggcccgagatcgccgccgagggcggttccctgatc
gatcccatgtgcggctcgggcacgctcgtcatcgagggcgccctgatcgctgccgacatc
gcgcccggtctcttgcgcaagcgtttcggtttccacggctggatccaacacgacgagctg
gcctggcagcgactgctggccgaggcgcgtctgcgtcggacggccggactcaaacggctc
ggcgcgttgcgcggctatgacatcgaccccaacgccatccgcgcctccctgcatcacctt
aagcgtgccggactcgccggtctggcccacttcgagtgccgcgagttggccgactgccgg
cccggacgggaagaggacgaggggctggtgatcgtcaacccaccctatggtgagcggctc
ggcgctaatgaggacctaggccagctctatgcgcgcctgggtatgctgcttagggagcgc
tttctcggctggcgcgcggcggtcttaaccgccaaccccgaactcggcaagcgcctgggt
ctgcgggcgacccggatccacagcctctacaatggtccgatcgaatgccggctgctgagc
tttcaggtcgagccgcgttacttcatcagtcatctgccgcgcccactgccgcccgcagaa
cgcagcccgggtgccaccatgctcgccaatcgattgaagaaaaacctccgggcgctgcgc
caatggcgtgaacgcgaaggcatcgactgtctgcgtctctatgacgccgacctgcccgag
tatgccctggcgatcgacctctacgagggcgaccggcgcttcgtgcatgtccaggaatat
gccgcgccgccgagcatcgatcccaagcaggcgcgccggcggctgcgcgaggccctgggt
ctgatccccgaggtgttggaggtgccctgcgaacaggtgttcctcaaggtacgccgtccg
cagaagggccgtgcccaatacgaacggctggcccagaccaggcgctttcatgaggtcgcg
gaatatggccacaggttcctggtcaacttcgaggactatctagacaccggactctttctc
aaccatcgcgaggtacggcggctgatcggcgcgctcgccgccggcaagcgtttcctcaac
ctctttgcctacacggggaccgcgaccgtatatgccgcaaagggcggggcggtctcgacc
accacggtcgatctgtcgcggacctatctgaactgggcagcgcgcaatctggagctcaac
gggatccaggggccgaatcatcggctcatccaagccgactgtctgcgctggatcgagtcg
atgttcggacggtgccgtttcgatctgatctttctcgacccgccgagcttctcgacctcc
aagcggatgcagggtacgctcgatatccagcgcgaccatgtcgccatcatccaatcgacc
atgcgtctgctcgaacccggcgggcggctgatcttttcaaacaatctgcgccgcttccgc
ctggatctggaggggctggcgcccttcgaggtcagcgacatcagcgcccagaccctgccg
cgcgacttcgcccgcaatccacgcctccaccactgctgggtgatccagcacccgggaccg
ccgccgcactggatggatcgcggtgacgacgaggtccgccatgcttga

DBGET integrated database retrieval system