KEGG   Thermobaculum terrenum: Tter_0308Help
Entry
Tter_0308         CDS       T01134                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00620  Pyruvate metabolism
ttr00680  Methane metabolism
ttr01100  Metabolic pathways
ttr01120  Microbial metabolism in diverse environments
ttr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tter_0308
  09102 Energy metabolism
   00680 Methane metabolism
    Tter_0308
Enzymes [BR:ttr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tter_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACZ41230
UniProt: D1CE74
LinkDB All DBs
Position
1:329369..332164
Genome map
AA seq 931 aa AA seqDB search
MAIERAGTGDKLSEDVRLLGSIVGEVLIEQGGRRLFEIVEKLRTTSIALRTRYSEELHRE
LVQITSELDPATAFDVIRAFNLFFLVVNLAEENHRVRVLRQREISSYPEPLEGSIREAVR
DLRNEDISDEQLQELLNRLRARFVFTAHPTESRRRTTLMHLRHISNLIALLDDALLTPTQ
REMVIDRLREVVTALWQTDDFRETRPTPLDEVYNSLYFFQESVFEILPSVYREFSDALKS
VYKDWNFQIPPVIQFGTWMGGDRDGNPNVTPEVTIRTARLQKGVLLRHYISQLDRLRRHL
SMSVRRAGVSDELMQSIEKERKILPEASERIEERNKNEMYRLKIGLMIEKLKNTLSAMEA
RQRPQPDVAYESVEQFYTDIDMIVNSLKQNKGDRLALGAAEDFRRLAEVFGFHLAKIDVR
QHSSRHSQAIAEVLSSVGICDRYLELSSEEQAELLRELLRDNRPIIGKVHHFSPSTEETI
AVFDAIRTIQEEIGKEACDTYIISFAQSAADLLEIQLLARETGLLSISEGWSRLQIVPLF
ESIHDLNECGNIMANLLDDPIYRCNVKAWGDHQEVMIGYSDSNKDGGFFTSCWELYKAQR
RLAAVCSERGVTLRLFHGRGGAIGRGGGPTHMAILGQPPDTIHGELKLTEQGEVIFARYG
NPAIAKRYLEQVLNALLRVSLSPTVIENQSRIEPEWQEAADTLSTYSYREYRNLVYETPE
FVEYFREATPIGEISLLPIASRPVRRQSGFDIEQLRAIPWVFSWMQSRHTLPGWYGLGTA
IEKYIAGDDSKLKILQEMYQKWIFFRSTLDNAQMILSKADIHVASMYAGLVSNPDVWNRV
WPRIQQEYERTVYWVIKVTGLNRLLDNAPVLQRSIMLRNPYVDPISYIQVALLRKLRTIP
DTKDHKKERESILQAVFLSINGIAAGLQNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagagagagctggcactggtgacaagcttagtgaggatgtacgcctccttgga
agcatagttggagaggtgctcatagaacaaggcggtcggcgattatttgaaatagtagaa
aagctcagaactacctctatagccttgcgtactaggtactcagaggaacttcatcgtgag
ttagttcaaataacctccgaacttgatcctgcgacagcctttgatgtaatacgagctttt
aacctcttctttctggtcgtgaatcttgctgaagaaaaccacagggtaagggtgctcagg
caaagggagattagtagttatcctgagcctctggaaggttcgattagagaggctgtaaga
gatctacgcaacgaggatatatcggatgagcagctgcaggagctattaaacagacttagg
gcaaggtttgtcttcactgcccatcctactgagtccaggcgaagaacgaccttgatgcac
cttagacatatatctaatctcatagccttgcttgatgatgctctcctgactcccacccaa
cgtgagatggttatagacaggctgcgggaagtagtaacagctctttggcagacagacgac
tttagagaaaccagacctactcctctggacgaggtctataacagcctctactttttccag
gagagtgtgttcgagattcttccctctgtctacagagagttctcagatgccttgaaatcg
gtatataaagactggaatttccagatacctcctgtcattcaatttggtacttggatggga
ggagatagggacggcaatcctaatgttacacctgaagtaactatacgtacagcgcgtctc
cagaaaggtgtattgctgaggcactatatatcccagctcgacaggcttcgcaggcatctc
tcgatgagtgttcgacgtgctggggtgagcgatgagctcatgcagtccatagagaaggag
agaaagatcctccccgaggcctctgaaaggatagaggagagaaacaagaacgagatgtat
cgcctgaagataggcctcatgatagaaaagctaaagaatactctctctgctatggaagct
agacagaggcctcagcccgatgttgcttatgagagtgtagagcagttctatacagatata
gatatgatcgtcaatagcctgaagcagaacaagggagacagactggctttaggcgcagca
gaggacttccggaggcttgctgaggtatttggatttcatcttgcaaagatagatgtgagg
cagcatagctctcgccacagccaggccatagcggaggtgttatcctcagtaggtatatgt
gacaggtacttggagctcagtagcgaggagcaagctgagctcctgcgtgagttgcttaga
gacaatcgacctatcataggtaaggttcaccacttttcaccttccaccgaagaaacaatc
gctgtctttgatgctatcagaaccatccaggaagagattggaaaagaagcttgtgacact
tacataataagctttgctcaatctgctgctgatctgcttgagattcagctgctggccaga
gaaactggtctactgtcgatatctgagggttggagcagacttcagatagtcccgttattt
gagagcatacatgacctaaacgagtgcggtaatataatggctaacctcctggatgaccct
atatatagatgcaacgtcaaggcatggggtgaccaccaggaagttatgataggttactcg
gactccaacaaggacggtggcttctttacgagctgttgggagctctacaaagctcagagg
cgtctggccgctgtgtgctctgagagaggcgttaccctaaggttgttccacggtagaggt
ggtgctataggtaggggaggagggccaacacatatggccatacttgggcaacctcccgat
accatacatggcgagctcaagctcaccgagcaaggtgaagttatatttgccaggtatggt
aatcctgcgatcgcgaagaggtatctggagcaggtgctgaacgctctactcagagtgagc
ctaagcccaaccgttatagaaaaccagagcagaatagaaccagagtggcaggaagccgca
gacactttgagcacctactcttatagagagtataggaatctagtgtatgagacgcctgag
ttcgtagaatacttccgcgaagctactcctataggcgagataagcctgctacccatagct
tcacgccccgtccgcaggcagagtggttttgatatcgagcagctcagggccatcccctgg
gttttctcctggatgcagagcaggcataccttaccagggtggtatggtcttgggactgct
atagagaagtatattgctggagacgattctaaactcaagatacttcaggagatgtatcag
aagtggatattcttcaggtctacattggacaacgctcagatgatactctctaaagctgat
atacacgtagcgagtatgtacgcgggattggtgagcaacccggatgtatggaatagggtt
tggcccaggatacagcaggaatatgaaagaactgtctactgggtaatcaaggtaactggg
ctcaacaggttgctcgataatgcgccagtgcttcagagatctatcatgctcaggaatcct
tatgtagatccaataagctacatacaggtagctctactacgcaagttgcgaacaattcct
gatactaaggatcataaaaaggaacgcgagagtatactgcaagcagtattcctctctatc
aacggcatagctgcaggtctacagaacactggataa

DBGET integrated database retrieval system