KEGG   Thermobaculum terrenum: Tter_0340Help
Entry
Tter_0340         CDS       T01134                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ttr  Thermobaculum terrenum
Brite
Enzymes [BR:ttr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tter_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACZ41262
UniProt: D1CEA6
LinkDB All DBs
Position
1:complement(370587..371198)
Genome map
AA seq 203 aa AA seqDB search
MHELPPLPYDYNALEPYIDEQTMRLHHDKHHGTYVNNLNQALEKYPELQNKSAEDLLRDI
NSIPEDIRTAVRNNGGGHVNHSMFWVIMKPNGGGEPYGPIADAIKQTFGSFEEFKRQFND
AGAKRFGSGWVWLVRTPDGQLQVISTANQDSPLMEGLYPIMGNDVWEHAYYLKYQNRRAE
YLEAWWNVVNWDEINRRFEQSSK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagttaccaccactcccatatgattacaatgcccttgagccctacatagatgag
cagaccatgaggctccaccatgataagcaccatggcacctatgtaaacaatctcaatcag
gcattagagaaatatccagagctacagaacaagagtgccgaggacttgcttagggatata
aacagcatacccgaggatatacgtacggctgtgcgcaacaatggtggtggtcacgtcaac
catagtatgttctgggtaatcatgaagccgaatggtggcggggagccttatggcccaata
gcagacgctatcaagcagacctttgggagcttcgaggagttcaagaggcagttcaacgat
gctggagcaaagaggtttggcagcggttgggtatggcttgtacgcactccagacggtcag
ctacaggtaatcagcactgctaaccaggatagcccacttatggaaggtctttatcccata
atgggcaacgacgtttgggagcacgcttactacctcaagtatcaaaaccgcagagcagag
tatctggaagcttggtggaacgtcgtcaattgggacgagatcaaccgccgctttgagcag
tccagcaagtaa

DBGET integrated database retrieval system