KEGG   Thermobaculum terrenum: Tter_0471Help
Entry
Tter_0471         CDS       T01134                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00564  Glycerophospholipid metabolism
ttr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tter_0471
Enzymes [BR:ttr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Tter_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored 3HCDH_N Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACZ41392
UniProt: D1CEN6
LinkDB All DBs
Position
1:complement(520601..522244)
Genome map
AA seq 547 aa AA seqDB search
MDELSRQEEWKSATSRNFDLAIIGGGIMGTGIARDAAMRGLKVALFEKEDFGHGTTAAAT
RLIHGGLRYLEMYDFKLVREDLREREILLRIAPHLVFPLSFILPLYDRGFIYRNKLRIGM
ILYDLLSYDKSLPNHTFLSRAETVRRLPGIAVDKLQGAAMYYDATAPLTERLCVENVISA
KENGAVVLNHAKVVGLLRSNSSINGVRVLDLLDGREYEVTSRLVINASGPWLNQVASDLG
LGDDIIRTTKGVHLVTPKISEDAAVLFARSDQRLFFVVPWLKFSYIGTTDTDYKGDMDEV
TATEEDVDYLLSEVKRAFPGQSFDTIYYTTAGVRSLAKIEGVPESKVTRKHIILDHYKRD
GIKGIISLIGGKLTAYRGISKDVVDLACEQLGVKIPSRTAAVPLPGGYTGKFSDYLLNQL
AGSADRYPLDAEQIEHMIRLYGSRYKEVAAMTIEDPDLSSRLHPDYPDSRADVKHAVTKE
YACTLADYMLRRSDIGFSEDRGEKAASAVGAEMAALLNWTKDRQDQEVESYLAFVRNSRL
SIPSGTF
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggatgagctttccagacaggaagagtggaagtcagcaacttccagaaacttcgactta
gcaatcataggcggcggaattatgggtacgggaatagcccgtgacgctgccatgagaggg
ctgaaggtagcactattcgagaaagaggattttggtcacggcacaaccgccgccgctacc
aggctcatacatggtgggctaagataccttgagatgtacgacttcaagttggtcagggaa
gacctgagagaaagagagattctcctgaggatagccccacacctggtcttccctctgtct
ttcatactccctctatatgatcggggcttcatttacagaaacaagcttagaataggcatg
atcctttatgacctactcagctacgacaagagtctgcccaaccacacattcctaagtagg
gctgagacagttagacgactacctggcatagctgttgacaagctacaaggggcagccatg
tactatgatgcaaccgcacccctcacagagcggttgtgcgttgaaaacgtcatctccgcc
aaagaaaacggtgctgtagtacttaaccatgccaaggtagttggcctactaagatctaac
agtagcatcaatggcgttagagttctggatcttctcgacggtcgggagtacgaggtaaca
tccaggctggtgattaatgcttccgggccttggctaaaccaggtggcatcagacctcggg
ctgggagatgatatcatccgaacaactaagggggttcatctggtaactccaaaaatcagt
gaagatgcagcggtattgtttgcccggagcgaccaaaggctgttcttcgtagttccctgg
ctaaagttctcctatataggtaccaccgataccgactataaaggtgacatggatgaagtc
acagctactgaggaagatgtagattacttgctgtctgaggtaaagagagcctttccaggg
caaagcttcgacaccatctactacacaaccgccggagtaagatcacttgcgaagatagag
ggcgtgcccgagtccaaggtgacaagaaagcatataatcctggaccactacaaaagggat
ggcatcaagggcataatctcgcttataggcggcaagctgacggcctacaggggcatatca
aaggacgtggtagacctcgcctgcgagcagcttggtgtgaaaatcccaagcaggaccgcg
gctgtacccctgcccgggggatatactggtaaattctcagattatctcctcaaccaacta
gccggctccgccgacagatatccgttggatgctgagcagatagagcacatgataaggctg
tatgggtccaggtacaaagaggtggcagctatgaccatcgaggacccagatctatcatca
aggctacatcctgactacccagatagcagagctgatgtcaagcacgcagttaccaaagag
tatgcatgtaccttagcggattacatgctacgaagaagcgacatagggttttcagaagat
agaggtgagaaggcggcaagcgccgtaggggctgagatggcagccctgctgaactggacc
aaagatcgccaggaccaggaagtagagagctacctggcattcgttcgaaattctcgcctc
agtataccttctggcactttctag

DBGET integrated database retrieval system