KEGG   Thermobaculum terrenum: Tter_0560Help
Entry
Tter_0560         CDS       T01134                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ttr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tter_0560
Enzymes [BR:ttr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Tter_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACZ41478
UniProt: D1CEX2
LinkDB All DBs
Position
1:complement(616503..618005)
Genome map
AA seq 500 aa AA seqDB search
MREYMNYIDGKWVPSSTGETFKSINPANGEVVAVLAKSSREDVDKAVQAARRAFDKWRLY
PAPRRGEILYEVGRILKERKEDLARLMTQEMGKVLTEARGDVQEGIDMAFYVGGEGRRLF
GVTTPSEMPNKFQMAVRDPVGVVAAITPWNFPIAIPTWKLMPALVAGNTVVFKPASDTPA
LGAELVKIFEEAGLPPGVLNLVTGTGEEVGKALLEHPGVDVISFTGSTDTGSQVLTQTAS
KNKKISLEMGGKNAITVMDDADIDLAIEGILWSAFGTTGQRCTACSRLIVHKSIRDTLTE
KLLSRIQNLRLGDGLDPETDVGPVINERQLNKIHQYVGIGREEGAKLLIGGDRATDGELS
KGFFYKPTLFTDVDPNMRIAQEEIFGPVLSMITVNSLEEAIKVNNCTKYGLSSSIYTRDI
NKAFRAMRDFNTGIVYINHGTIGAEVHLPFGGTKGTGNGHREGAVWAALDVFTEWKSVYI
DFSGRLQRAQIDIDKINIES
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagagagtacatgaactacatcgacggcaagtgggtaccttcatccacaggggaaacc
ttcaagagcataaaccccgccaatggggaagtggtagcggtcctggccaagtcttccaga
gaagacgtagataaagcggtacaggcggcgcgcagagccttcgataagtggaggctatat
cctgcacctagacggggagaaatactctatgaggtcggtcgcatcctgaaagaacgcaaa
gaagatctggccagacttatgactcaggagatggggaaggttctgacagaggctagggga
gacgtgcaggaaggcatagatatggccttctacgtgggtggagagggcaggaggctcttc
ggcgttaccactccttcggagatgcctaataagtttcagatggcagtcagggacccagtg
ggcgtcgtagcagctataactccctggaacttcccgatcgcgatccctacgtggaagctt
atgccagcgctagtggccggcaacaccgtagtgtttaaaccggcttctgatacccctgcg
ctgggggctgagctggtaaagatctttgaagaggcggggctacctccaggtgtccttaat
ctagtgacaggtacaggagaagaggtaggtaaggccctgcttgaacatcccggtgtggat
gtaatctcgttcaccggatccactgacactggctcgcaggtactaacacagactgctagc
aagaacaagaagatcagcctggagatgggcggcaaaaacgcgataactgtgatggatgac
gcagacatcgatctggcgattgagggcattctctggagcgcttttggcaccactggtcag
agatgtacggcctgtagccgactgatagttcacaagagcatacgagacacgcttacagag
aagcttctgtcccgcatccagaatctgcgactgggagacgggctggatccagaaacagat
gttggcccagtcatcaatgagaggcaactcaacaagattcatcagtacgtaggtatcggc
agggaggaaggagcaaagcttctcattggcggggatagagctacagatggagaattgagc
aagggcttcttctataaacccactctatttacagatgttgaccctaacatgcgtatagca
caggaagagatatttgggccggtactctcgatgataaccgtcaacagccttgaggaagcc
ataaaggtaaacaattgcacgaagtatgggctctccagctctatctatactagagatatc
aacaaggcatttagagccatgcgcgactttaatacaggtatcgtctacatcaaccacggt
actataggggcagaagtgcacctgccttttggaggcaccaaaggtacagggaatggacat
agagagggagccgtatgggctgcgttggatgtatttaccgaatggaagtctgtctatata
gacttcagcggcaggctgcagagagcacagatagatatcgataagataaatattgagtcg
tag

DBGET integrated database retrieval system