KEGG   Thermobaculum terrenum: Tter_1603Help
Entry
Tter_1603         CDS       T01134                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00473  D-Alanine metabolism
ttr00550  Peptidoglycan biosynthesis
ttr01100  Metabolic pathways
ttr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ttr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tter_1603
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tter_1603
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Tter_1603
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ttr01011]
    Tter_1603
Enzymes [BR:ttr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tter_1603
Peptidoglycan biosynthesis and degradation proteins [BR:ttr01011]
 Precursor biosynthesis
  Amino acid ligase
   Tter_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACZ42509
UniProt: D1CCJ4
LinkDB All DBs
Position
1:complement(1738499..1739587)
Genome map
AA seq 362 aa AA seqDB search
MKRYRLLLLFGGRSAEHDVSVASAISMMKALKDSDIDILPCGITREGTWKVGEEAVKMLA
SSALFAGDSDVRDIVPVDSQPRSVPEALSAVDVVFPLLHGPYGEDGTVQGFLELVNVPYV
GSGVLGSSLSMDKIAMKKMFESEGLPITRYLGILRSDWLSDPEGIISKIESELEYPVFVK
PANLGSSIGITKAKDRSSLLQALELASKYDRRLIVEQGVEARELECAVLGNDYPRASVVG
EILPGDEFYTFEAKYISESSKTIIPADIPPSVSDEIRDYAVRAFKAVDAAGLARVDFFLT
SENKVLVNEINTIPGFTPISMYPKLWEASGLSYPDLVRKLLDLAMERHADKQHRVIPLWE
AS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggtacaggttacttctgttgttcggtgggagatcagcagaacacgatgtgtcg
gtagctagcgctatatctatgatgaaggcgctcaaagatagcgatatagacattctccct
tgtggtatcactagagaggggacttggaaggttggtgaggaggcggtcaagatgctcgct
tcctctgctctctttgccggcgattcggatgttagggatatagtccctgtagattcacag
cctaggagtgttcctgaagccttgagcgctgttgatgtagtctttcccctgctgcatggc
ccttatggggaagatggcactgttcagggctttcttgagttagttaacgtaccatatgtt
ggttctggggtgttgggctcctccctgagcatggacaagatagctatgaagaagatgttt
gagtctgaggggctaccgatcacaagatacctggggatactgagaagtgattggctctcc
gaccctgaaggcattatttctaagattgaatcagagcttgagtatccagttttcgtcaaa
cctgcaaatcttgggtcaagcataggaattacaaaagctaaagatagaagctccttactg
caggcactagaattagcctcaaagtatgatcgcaggctgatagtcgaacagggagttgag
gctagagagctcgaatgtgcggttctcggaaacgattaccccagggcatctgttgttgga
gagatactaccaggagacgaattttatacattcgaagccaaatatataagcgaatcctcc
aagactatcattccagcagatataccaccaagtgtttctgatgaaattagagattacgca
gtcagagccttcaaggcagtggatgctgcaggtctggcaagagtagattttttcctaact
agcgaaaataaagtcctcgtaaacgagataaatacgataccaggattcacccctattagt
atgtatcctaagctatgggaagcttccgggctatcctatcctgatcttgtgaggaaactg
ttggatctagctatggagaggcatgctgataagcagcatagggttatccccctctgggag
gcttcatag

DBGET integrated database retrieval system