KEGG   Thermobaculum terrenum: Tter_2056Help
Entry
Tter_2056         CDS       T01134                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00040  Pentose and glucuronate interconversions
ttr00051  Fructose and mannose metabolism
ttr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tter_2056
   00051 Fructose and mannose metabolism
    Tter_2056
Enzymes [BR:ttr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Tter_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Shikimate_DH ThiF
Motif
Other DBs
NCBI-ProteinID: ACZ42960
UniProt: D1CGT9
LinkDB All DBs
Position
2:186196..187224
Genome map
AA seq 342 aa AA seqDB search
MRNEAAVLYGPHDVRLEERPVPVPGPREVLVEVRSVGVCGSDVHYYEHGRIGSFVVEQPL
VLGHESMGVVVGLGSEVTKHHVGERVALEPGVPCGTCRECRAGRYNLCPYVKFFATPPVD
GAFARYVTIHEDFAYALPDEISDDAGALVEPVSVGLWACRKARLRGGEHVLVTGAGPIGL
LAMQAAFALGAARVTVTDVVDERLQFARKVGATATVNVRSTPLVEAGVEADVLIECSGSP
TAVADGLRCLRPAGTAVLVGMGPGETVEIPVAYLQQHEIWLTGTFRYANTYPDAIELIRA
GKIRPEEIITGHYPLAEAESAMQATRRDPSQVKVMVLPQLEA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacgaagcagcagtgctctacggtccgcacgacgtgcgcctggaggagcggcca
gtgcctgtgccagggccacgggaggtgctggtggaggtcaggtccgtgggcgtgtgcggc
tccgacgtacattactacgagcatggcaggataggtagcttcgtcgttgagcagcccctg
gtgctggggcatgagtccatgggcgtggtggttggcctgggcagcgaggtcacgaagcac
catgtgggcgagagggtggcgctggagccgggcgtgccgtgcggcacctgccgggagtgc
cgtgccggcaggtacaacctgtgcccgtacgtcaagttcttcgcgacccctccggtggac
ggggccttcgcgaggtacgtcaccatccacgaggacttcgcctacgccctgcccgatgag
atctcggacgatgccggcgcgctggtggagccggtctcggtggggctgtgggcgtgcagg
aaggcgcggctgcgaggcggggagcacgtgctggtgaccggtgccggcccgatcggcctg
ctcgccatgcaggcggccttcgctctgggggctgccagggtgacggtgaccgacgtggtc
gacgagcgcctgcagttcgcccgcaaggtcggagcgacggccacggtcaacgtccgcagc
acacccctcgtcgaggccggggtcgaggccgacgtcctcatagagtgctccggcagcccc
accgcggtcgccgatggcctgaggtgcctccgtcccgcgggtacggctgtgttggtgggc
atggggcccggggagacggtcgagatacctgtggcgtacctgcagcagcacgagatctgg
ctcaccggcaccttccggtacgccaacacctatcccgacgccatcgagctgatccgggca
ggcaagatacgccctgaggagatcatcaccgggcattacccgctcgccgaggccgagagc
gcgatgcaggcgaccaggcgggacccctcccaggtcaaggtcatggtgctgccccagctg
gaggcctag

DBGET integrated database retrieval system