KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0568
Entry
Ththe16_0568      CDS       T01867                                 

Definition
(GenBank) GTP-binding proten HflX
  KO
K03665  GTPase
Organism
tts  Thermus thermophilus SG0.5JP17-16
Brite
KEGG Orthology (KO) [BR:tts00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tts03009]
    Ththe16_0568
Ribosome biogenesis [BR:tts03009]
 Prokaryotic type
  GTPases
   Ththe16_0568
SSDB
Motif
Pfam: GTP-bdg_M GTP-bdg_N MMR_HSR1 FeoB_N GTP_EFTU cobW AAA_16 AAA_23 ABC_tran Integrase_Zn MMR_HSR1_Xtn MobB
Other DBs
NCBI-ProteinID: AEG32994
UniProt: F6DEW4
LinkDB
Position
531551..533203
AA seq 550 aa
MDKVFGRTQGLKKSELKRISNLYRRRLPKDRVLTPELAHTLAALSAEVGRPLSLVLDREG
RVVRVAVGDAKDVPFPEEGWSERRLSGYRLLHTHLGPGGLSRPDLSVLFLRRLDNLAALE
VEADGRPGLLHLAFLSPPRALEEDWRVLPPKPFHQYLDLDLWGEVMALEEELSRQARVLE
VRDGSGERALLVGVDTGEGPEAEAVLRELAELTRTAGGVPVKQILVFRKSLDPRYLVGLG
KLEELKSLAYHENASTLIFGVDLTPAQAREIERVTGLKVLDRTQLILDIFALHAKTPEAQ
AQVELAQLRYLLPRLVGKGKEMSRLGGGIGTRGPGETKLEVDRRRLQDRIAHLSRKLQDY
ALRRKEARQKRKRRGVPLVAVVGYTNAGKTTLLRALTRAGEEGEDKLFATLRPLTRRGFL
PGVGEVLFTDTVGFIRHMPEELLTAFRATLEEVREADVLVHVLDASEEGALERHRVVRDL
LLDLGVEAPVVLALNKADRAAPYDLYFLGERLGGVPVSALKGTGLKELKEALARALLDLG
VRPQAWAQYT
NT seq 1653 nt   +upstreamnt  +downstreamnt
ttggataaggttttcgggcgcacgcaagggctcaagaagagcgaactgaagcggatttcc
aacctgtaccggaggcgcctccccaaggaccgggtcctcaccccggagctcgcccacacc
ctggcggccctctccgccgaggtgggcaggcccttgagcctcgtcctggaccgggagggg
cgggtggtgcgggtggccgtgggggacgccaaggacgtgcccttccccgaggaggggtgg
agcgagaggcggctttccggctaccgcctcctccacacccacctgggccccggggggctt
tcccggcccgacctctccgtcctcttcctcaggcggctggacaacctggccgccttggag
gtggaggcggacgggcgcccgggccttttgcacctcgccttcctctcgccgcccagggcc
ctggaggaggactggcgggtcctgccgcccaagcccttccaccagtacctggacctggac
ctctggggcgaggtcatggccctggaagaggagctttcccgccaggcccgggtcctcgag
gtccgggacgggagcggggagcgggccctcctggtgggggtggacacgggggagggcccg
gaggcggaggcggtcttgcgggagcttgccgagctgacccggaccgcagggggcgtgccg
gtgaagcagatcctggttttccgcaagagcctggacccgcggtacctggtgggcctcggc
aagctggaggagctcaagagcctggcctaccacgaaaacgcctccaccctcatcttcggc
gtggacctcaccccggcccaggcccgggagattgagcgggtcacgggccttaaggtcctg
gaccggacccagctcatcctggacatcttcgccctccacgccaagacccctgaggcccag
gcccaggtggagctggcccagctccgttacctcctcccccggctcgtggggaaggggaag
gagatgagccgcctcgggggtgggatcgggacccggggccccggggagacgaagctggag
gtggaccggcgccgcctccaggaccggatcgcccacctctcccgcaagctccaggactac
gccctccgccgcaaggaggcgaggcagaagcggaagcggcggggcgtgcccttggtggcg
gtggtgggctacaccaacgccggcaagaccaccctcctccgcgccttaacccgtgccggg
gaggagggggaggacaagctcttcgccactctaaggcccctcacccgcaggggctttctg
ccgggggtgggggaggtcctcttcaccgacaccgtgggcttcatccgccacatgccggaa
gagctcctcaccgccttccgggcgaccctggaagaggtgagggaggcggacgtcctggtc
cacgtcctggacgcctcggaggagggggcgctggagcggcatcgggtggtgcgggacctg
cttttggacctcggggtggaggcccccgtggtcctcgccctcaacaaggcggaccgggcg
gccccctacgacctctatttcctgggggagcgcctggggggcgtccccgtatccgcccta
aagggaacggggcttaaggagctcaaggaggccctcgcccgggccctgctggaccttggg
gtccgtccccaggcctgggctcagtacacgtga

DBGET integrated database retrieval system