KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1401Help
Entry
Ththe16_1401      CDS       T01867                                 

Definition
(GenBank) GTP-binding protein engA
  KO
K03977  GTPase
Organism
tts  Thermus thermophilus SG0.5JP17-16
Brite
KEGG Orthology (KO) [BR:tts00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tts03009]
    Ththe16_1401
Ribosome biogenesis [BR:tts03009]
 Prokaryotic type
  GTPases
   Ththe16_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 FeoB_N KH_dom-like Dynamin_N AIG1 GTP_EFTU RsgA_GTPase Ras Roc SRPRB ABC_tran cobW Nuc_deoxyri_tr2 MMR_HSR1_Xtn AAA_33 AAA_24 SRP54 AAA_16 TniB ATPase_2 AAA_29 Guanylate_kin HTH_12 Gtr1_RagA DUF3352
Motif
Other DBs
NCBI-ProteinID: AEG33803
UniProt: F6DIH5
LinkDB All DBs
Structure
PDB: 

Position
1352259..1353554
Genome map
AA seq 431 aa AA seqDB search
MHKVVIVGRPNVGKSSLFNRLLKKRSAVVADVPGVTRDLKEGVVETDRGRFLLVDTGGLW
SGDKWEKKIQEKVDRALEDAEVVLFAVDGRAELTQADYEVAEYLRKKGKPVILVATKVDD
PKHELYLGPLYGLGFGDPIPTSSEHARGLEELLEAIWERLPVRQIETEPEVAGIRLAIVG
RPNAGKSSLLNAILGEERVIVSEEPGTTRDAIDVEFFFGGQRFVLVDTAGIRKRPESLVE
ELAIRRSLRAMDEADVVLLVVDPFQVGDRELKLANEALDRGKPVLLVITKWDLVDKEDAP
KMRRLLREKLAHLDHLPRVFTSALTRQNLDRIFREAVRLHELNQTRVPTAELNRWVAVWT
SRVQMPNFKGKPLKILYATQPEVAPPTFVFFVNHPEFVTRAFENYLKNRIGEDLGLREVP
FRLVFRGRREE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggtggtcatcgtgggcaggcccaacgtgggcaaatccagcctcttcaaccgc
ctcctcaagaagcggagcgcggtggtggcggacgtgcccggggtcacccgcgaccttaaa
gagggcgtggtggagaccgaccggggccggttcctcctggtggacacgggggggctctgg
tccggggacaagtgggagaagaagatccaggagaaggtggaccgggccctggaggacgcc
gaggtggtgctcttcgccgtggacgggcgggccgagctcacccaggcggactacgaggtg
gccgagtacctgcgcaagaaggggaagcccgtgatcctcgtggccaccaaggtggacgac
cccaagcacgagctctacctgggccccctctacggcctcggcttcggcgaccccatcccc
acctccagcgagcacgcgagggggctggaggagctcctcgaggccatctgggagaggctt
cccgtacgccagatagagaccgagcccgaggtggcgggcatccggctcgccatcgtgggc
cggcccaacgccgggaagtccagcctcttgaacgccatcctgggggaggagcgggtcatc
gtctccgaggagccgggcaccacccgggacgccattgacgtggagttcttcttcggcggc
cagcgcttcgtcctcgtggacaccgccgggatccgcaagcggcccgaaagcctcgtggag
gagctcgccatccggcggagccttagggccatggacgaggcggacgtggttctcctcgtg
gtggaccccttccaggtaggggaccgggagctgaagcttgccaacgaggccctggaccgg
ggcaagcccgtccttttggtcatcaccaagtgggacctggtggacaaggaggacgccccc
aagatgcggcgcctcctccgggaaaagctcgcccacctggaccacctcccccgggtcttc
acctccgccctgacgcggcagaacctggaccggatcttccgggaggcggtgcgccttcac
gaactcaaccagacccgcgtccccaccgccgagctcaaccgctgggtggcggtctggacg
agccgcgtgcagatgccgaacttcaagggcaagcccctcaagatcctctacgccacccag
cccgaggtggccccgcccaccttcgtcttcttcgtgaaccacccggagttcgtcacccgg
gcctttgagaactacctgaaaaaccgcatcggcgaggacctgggcctaagagaggtgccc
ttccgcctggtcttccgggggaggagggaggagtag

DBGET integrated database retrieval system