KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1960Help
Entry
Ththe16_1960      CDS       T01867                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00010  Glycolysis / Gluconeogenesis
tts00030  Pentose phosphate pathway
tts00051  Fructose and mannose metabolism
tts00052  Galactose metabolism
tts00680  Methane metabolism
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01130  Biosynthesis of antibiotics
tts01200  Carbon metabolism
tts01230  Biosynthesis of amino acids
tts03018  RNA degradation
Module
tts_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_1960
   00030 Pentose phosphate pathway
    Ththe16_1960
   00051 Fructose and mannose metabolism
    Ththe16_1960
   00052 Galactose metabolism
    Ththe16_1960
  09102 Energy metabolism
   00680 Methane metabolism
    Ththe16_1960
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Ththe16_1960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tts01009]
    Ththe16_1960
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tts03019]
    Ththe16_1960
Enzymes [BR:tts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ththe16_1960
Protein phosphatases and associated proteins [BR:tts01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ththe16_1960
Messenger RNA biogenesis [BR:tts03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ththe16_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peptidase_C13
Motif
Other DBs
NCBI-ProteinID: AEG34351
UniProt: F6DG14
LinkDB All DBs
Position
complement(1853310..1854278)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANI
IQRGGTILLTARSQEFLTKEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCLVEEHGMPV
VGVPGTIDNDLYGTDFTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMGRHAGFIALD
VGLAGGAEVIAVPEEPVDPKAVAEVLEASQRRGKKSSIVVVAEGAYPGGAEGLLAAIQEH
LQVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALVGGASGVMVGEVEGEVDLTPLK
EAVERRKDINRALLRLSQVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggggtgttcaccagcggcggcgatgcgccggggatgaacgcggccatc
cgggcggtggtgcgccaggcccacgcccttggggtggaggtcatcgggatccgccgcggc
tacgccggcatgatccaaggggagatggtgccccttggggtgcgggacgtggccaacatc
atccagcggggcgggacgatcctccttacggcgaggagccaagagttccttacgaaggag
gggcgggccaaggcctacgccaagctgcaggcggcggggattgagggcctggtggccatc
ggtggcgacgggaccttccgcggggcgctttgcctcgtggaggagcacgggatgccggtg
gtgggggtcccgggcaccatagacaacgacctctatggcacggacttcaccatcggcttt
gacaccgcggtgaacacggccctcgaggccatagaccgcatccgggacaccgcggcaagc
cacgagcgggtcttcttcatcgaggtcatggggcggcacgcggggttcatcgccctggac
gtggggcttgccggcggggcggaggtcatcgccgtccccgaggagcccgtggaccccaag
gccgtggccgaggtgctggaggcctcccagaggcgtgggaagaagagctccatcgtggta
gtggccgagggggcctaccccggcggggccgaggggcttctcgccgccatccaggagcac
ctccaggtggaggcccgggtcaccgtcctggggcacatccagcggggcgggagccccacg
gccaaggaccggatcctggcgagccgcctgggggcggccgcggtggaggccctggtgggc
ggggcgagcggggtcatggtgggggaggtggagggcgaggtggacctcacccccctgaag
gaagcggtggagcgcaggaaggacatcaaccgggccctcttgcgcctatcgcaggtgctg
gccctctag

DBGET integrated database retrieval system