KEGG   Thielavia terrestris: THITE_122520Help
Entry
THITE_122520      CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ttt  Thielavia terrestris
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ttt03036]
    THITE_122520
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     THITE_122520
Chromosome and associated proteins [BR:ttt03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     THITE_122520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 11519439
NCBI-ProteinID: XP_003657088
JGI: Thite2_122520
UniProt: G2RDB3
LinkDB All DBs
Position
5:join(3496497..3499977,3500023..3500126)
Genome map
AA seq 1194 aa AA seqDB search
MAHPAHSDSNKHEEGDGGLAKSLERLTIGPTGTPPASRPAAPSPLKPVADKSPISPRPGS
AMRSPLRSASASTVPSTRSASPALLRKASMNSLHSANGVTPSRRSSSANILSPSKPRSGR
SPLRSVSPEPPPRPVPTPQSVASAHFKAELEAHHGPEPTRRSETVVILQDACYGHRFSRP
RTSRAQLSTIFERPERIKACVLGVSAAYVRLGERHQDGAFPPQSETDAASLPSIPFRIRK
STRRLSLGSQTVTNVHGTKWMEELKLMCETAEAKLAGGNRELQRPDIDRGPNADPPQKLH
EGDLYLCSESLNAMEGALGGVCDAVDAVFETNGPQRAFVAIRPPGHHCSASHPSGFCWIN
NVHVGIMHAVLSHGLTHAAIVDFDLHHGDGSQSIAWQHNARGVGLAKNAAWWKKTSIGYF
SLHDINSYPCETGDEDKVRNASICIDNAHGQSIWNVHLQPWKTEADFWALYESKYAVLLE
KTRAYLRNHTERLRASGLNSRAAIFISAGFDASEHEDPAMQRHNVNVPTEFYARFTRDLV
RIAAEEGTSAEGRIISVLEGGYSDRALCSGVFSHLCGLAGDGPCNRDQESSGYEAVQKAV
QQRARKDSTASERGARRYESSWWSLSELELLEETLRKPPPVPKLISNSPPPTYSSPTVSS
QAKVVTPKNRRSVSGLSSASSNNSTPKVSYERLPPTDVPWTIATQELSKLLIPSGRQTTS
CTAEELNAEATRIRRERQAAIAASVPAIATPAAEDRPSTRMGLRERKTKPTYVFDDEFDH
KSRRKTVAGPAVLATEAASRGPTPMPGKQSRASRRLSAASTVVSSEGTDSIASEPVAPRP
APVQGDAKADITSKAEAATTVAGASGSSLNVKKTRAPKKEPAPRAPRAPKKQPAAANGAP
RQTAPAATATSAGAPTQKAGDEVDKLAGEMKKIKITVVTKAQKEARERERAAREKLANAE
AVSVPPSPAKGDPLPQPAPESAQTSSNAVHLPSPTPSPTPQQPQVQTSLDPSTPSLKEAV
KTPTTTTATGSLASPPTTDPRHVSLPASSPPPPSSSEPTHPQPGLTSPVQQHPPPPPQDN
FIPYQPDGPPPTSVPNHQQQQPPPPLQWLPPNVSATPLQSPAKRADLPVFTSTSVIPFAP
RGAASAAGGGAAATPSGGGGGGAGAAGNGMVGAERRESAGAVGKGKGAGEERGA
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggctcacccagcgcattccgacagcaacaaacatgaggagggcgacggtggtctggca
aaatctctggaacgcttgaccatcggccctaccggcacccctcccgcctcccgacctgcc
gctcccagcccgctcaagcctgtcgccgacaagtcacccatctcgccacgcccgggaagc
gccatgcgcagccctctccgcagcgcttctgcttctaccgtcccgtcgacccgttcagct
tcgcccgccttgctgcggaaggcatccatgaactcgctgcattccgccaacggcgtcacc
ccgtcccgtcgctccagctcagccaacatcttgtcgcccagcaaacccagatctggcagg
tcgcctctcaggagcgtgtctcccgaaccgcccccgaggcccgttccaacacctcaatcc
gtcgcaagcgcccacttcaaggccgagctggaggcccatcacgggcccgagccgacccgc
cgcagcgagactgtcgttatccttcaagacgcctgttacgggcatcgcttctcccgtcct
cgcacatctcgcgcacaactcagcaccattttcgagcggcccgagaggataaaggcctgc
gtcttgggcgtttctgcggcgtatgtacggctgggtgagcgacatcaggacggagccttt
cccccacagtccgaaaccgacgccgcctccttgccctcgatacccttccggattcggaag
tcgaccaggcggctgtctttgggttcccaaaccgtgaccaacgtgcacggcacaaaatgg
atggaggagctgaagttgatgtgcgagacagccgaggcgaagctggccggcggcaacaga
gagctccagcggccggatatcgatcgcggtccgaacgcagatccgccccagaaactccac
gagggcgacctctacctgtgctctgaatccctgaacgccatggagggggcgctgggcggt
gtgtgcgacgccgtcgatgcagtattcgagaccaacggaccgcagcgcgcgtttgtcgcc
atccggccccccggtcaccactgctctgcgtctcacccgtcgggcttttgctggatcaac
aacgtccacgtcggcatcatgcatgccgtccttagccacggcttgacccatgctgcgatc
gtcgactttgatctgcaccacggcgacggctcgcagtccattgcttggcagcacaacgcg
cggggcgttggcctcgccaagaacgcagcttggtggaagaagacatcaatcggctacttc
agcctccacgacattaactcttatccatgcgaaacgggcgatgaggacaaggttaggaac
gcaagtatctgcatcgacaatgcgcatggccagagcatatggaacgtccacctgcagcct
tggaaaactgaggccgatttctgggccttgtatgagtccaagtatgcagttctgctcgaa
aagacgcgcgcttacctcaggaatcacaccgagaggctgcgggcctcgggtctgaactcg
agagccgccatctttatctcggcgggctttgatgcgagcgaacatgaggatcccgcgatg
caacggcacaacgtcaacgtgccgaccgagttctacgcacgcttcacccgcgacctggtc
cgcattgcggcagaagaagggacgagcgcggaaggccgcattatcagcgtcctcgagggc
ggatacagcgaccgtgcgctctgctccggcgtgttcagccacctctgcggtctcgccgga
gatgggccgtgcaacagggaccaagagtccagtggctacgaagcggtccagaaggctgtc
cagcagcgtgcgcggaaagactcgactgcgagcgagcggggtgcgcggcgctacgagtcg
tcgtggtggtccctttccgagcttgaactgctggaagaaactctccgtaaacccccgccg
gtgccgaaactcattagcaactcgccgccgccaacgtactcctcgccgaccgtgtcatca
caggccaaggttgtgaccccgaagaatcggcggagcgtgtccgggctgtcgtcggcctcg
agcaataatagtacaccgaaggtctcatacgagcggctacctcccacagacgtcccctgg
accatcgcgactcaggagctgagtaagcttctcataccaagtgggcgtcagaccaccagc
tgcacggccgaggagctcaatgcggaggccacccgcattcggcgcgaacgtcaggccgca
atcgctgcgtcagtccctgcgatcgccactccagcagcggaggatcgtccctccacgaga
atggggctgagggagcggaaaacgaagccgacctacgttttcgacgacgagtttgatcac
aagagcagacggaagaccgtcgcggggccggccgtcctcgctaccgaggcagcgtcccgg
gggccgactcccatgccggggaagcagtcgagagcatcacggcgccttagtgcggcgtcg
accgtcgtgtcttccgaaggcacggattccatcgcctcggagccagtagctccgcgaccc
gcgccggttcagggcgacgccaaggcggacatcaccagcaaggccgaagccgcgacgacc
gtggcgggcgctagcggcagcagtctcaatgtgaaaaagacgcgggctccgaagaaagag
ccggctccgcgagctccacgggcgccaaagaagcagcctgcggcggcaaatggagcgccg
cggcaaacggctcccgctgcaacggcgacttctgccggcgcgccgacccaaaaggccggc
gatgaggttgacaagctggccggcgagatgaagaagatcaaaatcacggtggtcaccaaa
gcgcagaaggaggcccgcgaaagggagcgtgcggcgagggagaagctcgcaaacgcagag
gctgtatcagtgccgccatcaccggccaagggagaccctctcccgcagcctgcccccgaa
tccgcccaaacctcctccaacgccgtgcacctcccctcgccaactccatctccaacgcca
cagcagccacaagtccaaacctcactcgacccctcaactccctctcttaaagaagccgtc
aagaccccgactaccaccaccgccacaggctccctcgcctccccgcccaccaccgacccg
cgccatgtttccctcccagcaagctcgcccccgccaccatcatcatcggaaccaacacac
ccacaacccggcttgaccagccccgtccagcagcacccacctcctccaccgcaagataac
ttcatcccttaccaacccgacggcccgcccccgacatcagtgcccaaccaccagcagcag
cagccgccgccgccgctgcagtggctcccgcccaacgtgtctgccacgccgctgcagtcg
cccgctaagagggccgatctgcccgtgtttaccagcaccagtgtcatacccttcgcgccg
aggggtgctgcttccgccgccggcggcggggctgctgctactcccagtggtggtggtggt
ggtggtgctggggctgctgggaatgggatggtgggggctgagcgtcgtgaaagcgcaggt
gctgtggggaaggggaagggggccggcgaggagcggggtgcctga

DBGET integrated database retrieval system