KEGG   Thielavia terrestris: THITE_164568Help
Entry
THITE_164568      CDS       T02228                                 

Gene name
gla1
Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ttt  Thielavia terrestris
Pathway
ttt00500  Starch and sucrose metabolism
ttt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THITE_164568 (gla1)
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     THITE_164568 (gla1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 CopC
Motif
Other DBs
NCBI-GeneID: 11515603
NCBI-ProteinID: XP_003650932
JGI: Thite2_164568
UniProt: G2QUZ8
LinkDB All DBs
Position
1:join(9274710..9274950,9275005..9275226,9275290..9275437,9275507..9275580,9275645..9275776,9275841..9276940)
Genome map
AA seq 638 aa AA seqDB search
MRRLQLLGLLALLPAALGHPEASRVRREGEVVKRSVDSFIATESPIALSNLLCNIGSTGC
HASGVASGIVVASPDKTNPDYWYTWTRDSALTFKCVVDTFTNSYDASLQAEIQNYIVAQA
HLQGVSNPSGSLSDGSGLGEPKFNVDMSQFTGAWGRPQRDGPALRAIALIAYSKWLISNG
YTSTASSIVWPVIKNDLAYVAQYWNNTGFDLWEEVSGSSFFTVANQHRALVEGAALATSL
GTSCSACSAVAPQILCFLQSFWSPSSGYILANINENNGRSAKDANTLLGSIHTFDPAAGC
DAATFQPCSDRALANHKVVTDAFRSIYSINSGIAEGSAVAVGRYPEDSYFGGNPWYLNTL
AAAEQLYDALYVWKKQGSITVTSTSLAFFKDFSSSITPGTYSSSTSTYTTLYNAISAYAD
GYMNIVAQYAQTNGSLSEQFSKTNGEPLSAYDLTWSYAAFLTAAARRAGVVPPSWGAASA
NSVPAQCSATSVVGSYTSATATSFPPSQTPASSTSAGSSPASSTTATATACSTPTAVAVT
FNERVTTQWGQTIKVVGDAAALGGWDTSKAVPLSAAGYTASDPLWSGTVDLPAGLAVQYK
YINVAADGGVTWEADPNHSFTVPAACGTTAVTRDDTWQ
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtcttcagctcttgggcttattggccctgcttcctgctgcgctcggccatccg
gaggctagccgtgtccggcgcgagggggaggtggtgaagaggtctgtcgactccttcatc
gccaccgagagccccattgccttgtccaacctgctctgtaacatcggctcaactggctgc
catgcttctggcgtcgcctcgggtatcgtcgttgcgtccccggacaagacgaacccggac
tactggtatacttggactagagacagcgcgctcaccttcaagtgcgttgtcgacaccttc
accaacagctacgatgcctcgctccaggcggagatccagaactacatcgtcgcgcaggcc
catctgcagggcgtctcgaacccgtccggcagcctctcggacggttccggcctgggagaa
cccaagttcaacgtcgacatgagccagttcacgggcgcctggggtcgaccacagagagac
ggtccggctctccgggcgatcgccctgatcgcttactcaaagtggctgatcagcaacggg
tacacttcgactgcgtcgagcatcgtctggcccgtcatcaagaacgatctggcatacgtt
gcccagtactggaacaacacaggtttcgatctttgggaggaagtctctggcagttccttc
ttcacggtcgccaaccaacacagagcattggtggagggtgccgcccttgccacgtcgctc
ggtacttcttgcagtgcctgctctgccgtcgcgccccagatcctgtgcttcctgcagagc
ttctggtcgccctccagcggctatattctcgccaacatcaacgagaacaacggccgcagc
gccaaggacgcgaacacattgctgggctcgattcacacgtttgatcccgccgcgggctgc
gacgcggcgactttccagccctgcagtgaccgggcgctggccaaccacaaggtcgtgacc
gacgcgttccggtccatctactccatcaactccggcattgccgagggcagcgccgtcgcg
gtcggccgctatcccgaggacagctacttcggcggcaacccctggtacctcaacacactg
gccgccgccgagcagctgtacgatgccctctacgtctggaagaagcagggctccatcacc
gtcacatcgacgtcgctggccttcttcaaagacttctcgtcgtccatcaccccgggcacg
tactcctccagcacgtcgacgtacacaaccctgtacaacgccatctcggcgtacgccgac
ggctacatgaacatcgtcgcccagtacgcgcagaccaacggctcgctgtcggagcagttc
tccaagaccaacggcgagccgctctccgcctacgacctgacctggtcctacgcggccttc
ctcacggcagcggcccgccgcgccggcgtcgtgcccccctcctggggcgccgcctcggcc
aacagcgtcccggcgcagtgctccgccacctccgtcgtcggctcctacacctccgcgacc
gcgacctccttcccgccgtcgcagaccccggcatccagcacctccgccggctccagcccc
gcttcttccaccaccgccaccgccaccgcctgctccaccccgaccgccgtcgccgtcacc
ttcaacgagcgcgtgaccacccagtggggccagacgatcaaggtggtcggcgacgcggcc
gcgctcggcggctgggacaccagcaaggccgtgccgctcagcgccgccggctacaccgcc
agcgacccgctgtggtcgggcaccgtcgacctgcccgccggcctggccgtgcagtacaag
tacatcaacgtggcggccgacgggggcgtcacgtgggaggcggatccgaatcattcgttt
acggtgccggctgcgtgcgggaccacggcggtaaccagggatgatacctggcagtaa

DBGET integrated database retrieval system