KEGG   Thielavia terrestris: THITE_2083750Help
Entry
THITE_2083750     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ttt  Thielavia terrestris
Pathway
ttt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    THITE_2083750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ttt02000]
    THITE_2083750
Enzymes [BR:ttt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     THITE_2083750
Transporters [BR:ttt02000]
 Other Transporters
  Pores ion channels [TC:1]
   THITE_2083750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2 GST_N
Motif
Other DBs
NCBI-GeneID: 11521347
NCBI-ProteinID: XP_003648560
JGI: Thite2_2083750
UniProt: G2QW53
LinkDB All DBs
Position
1:join(175856..176455,176524..176718)
Genome map
AA seq 264 aa AA seqDB search
MASEVPPKRQKSAKDVPYHLIYWPGIPGRGEHVRLALEEAGAEYTDTAFTDGGVDEVLAY
VQGKIPDDGLNPPPCAPPILKHGDLVISQTPNILLYLGNRLGLVPDADQDPDAMYKINAL
ALTALDGLSNEPHDCHHPIASGLYYEDQKEEAKRRSEDYVKNRLPKFLSYFERVLESKAS
GDGPWLYGGALTYADLVLFQCVDGVKFMFPKAMAKLERGGKHAKVFQLYQAVAERPKIKA
YLQSDRRQKYSNGIYRYYEELDFA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgaagtcccccccaagcggcagaagtccgccaaggacgtgccctatcaccta
atctactggcctggcattcccggccgcggcgagcatgtgcgcctcgcgctggaggaggcg
ggggccgaatacaccgacaccgcattcaccgacggcggggtagacgaggtgctcgcctac
gtgcaaggcaagatccccgacgacggcctcaaccctccaccgtgtgcgccgccgatcctg
aaacacggggatcttgtcatcagccagacgccaaacatcttgctttacttggggaatcgc
ctcggtctcgtgccggacgccgaccaagatcccgacgccatgtacaagatcaatgcgctg
gcgctgacggcgctggatgggctgagcaacgaaccgcacgattgccatcacccgatcgcc
tctgggctctactacgaggaccagaaggaggaggccaagaggaggtccgaggactacgtc
aaaaaccggttgcccaaatttctgtcgtactttgagcgagtgctcgagtccaaggctagc
ggcgacggcccgtggctctacggcggggcgctgacttacgcagacctggtactcttccag
tgtgtggacggcgtcaaattcatgttcccaaaggccatggcgaagttggagcgagggggc
aagcatgcgaaagtcttccagctctaccaggccgtcgccgagcgtcccaagatcaaggcc
taccttcaaagcgaccgcaggcagaagtattccaacggtatttacaggtattatgaggag
ctggattttgcatag

DBGET integrated database retrieval system