KEGG   Thielavia terrestris: THITE_2108025Help
Entry
THITE_2108025     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ttt  Thielavia terrestris
Pathway
ttt04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    THITE_2108025
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     THITE_2108025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 11517530
NCBI-ProteinID: XP_003649465
JGI: Thite2_2108025
UniProt: G2QWW5
LinkDB All DBs
Position
1:join(3683004..3683642,3683696..3683809)
Genome map
AA seq 250 aa AA seqDB search
MVNIGSLWQYLAAHSPLQSTLSSLSTTTMSGGALNLTQMGLAPYSLPPLPYAYDALEPHI
SAQIMELHHGKHHQAYVTNLNAALASHVSAVAAGDVAAQIALQQAIKFNGGGHINHSLFW
KNLAPPGTEETNPAVAKELVSAIEKKWGSLESFKKAFSAALLAIQGSGWGWLVKEAGNGA
GLRIVTTKDQDPVVGGDVPIFGVDMWEHAYYLQYLNGKAAYVENIWNVINWRTAEDRFVG
RNEENVKTEL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacatcggcagcctgtggcagtacctggccgcgcactcgccgctgcagtccacc
ctgtcctccctgtccaccacgaccatgtcgggcggcgccctcaacctcacccagatgggg
ctggccccttactcgctgccgccgctgccctatgcctacgacgcgctcgagccgcacatc
tcggcccagatcatggagctgcaccacggcaagcaccaccaggcttacgtgaccaacctc
aacgcggccctggcctcgcacgtctccgccgtggccgctggcgacgttgccgctcagatc
gccctccagcaggccatcaagttcaacggcggcggccacatcaaccactcgctgttctgg
aagaacctggccccgcccggcaccgaggagacgaacccggccgtggccaaggagttggtc
tcggccatcgagaagaagtggggcagcctggaaagtttcaagaaggcattctcggccgcg
ctgctggcgatccagggcagcggttgggggtggctggtcaaggaagcgggcaacggcgcc
ggtctgcgcatcgtcaccaccaaggaccaggatcccgtggtagggggtgacgtgcccatc
tttggcgtcgacatgtgggagcacgcatattacctccagtatctgaatggcaaggctgcc
tatgtcgagaatatctggaacgtcattaactggaggacggcagaggaccgttttgtgggg
aggaatgaggagaacgtgaagactgagctctga

DBGET integrated database retrieval system