KEGG   Thielavia terrestris: THITE_2109377Help
Entry
THITE_2109377     CDS       T02228                                 

Definition
(RefSeq) glycoside hydrolase family 2 protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ttt  Thielavia terrestris
Pathway
ttt00052  Galactose metabolism
ttt00511  Other glycan degradation
ttt00600  Sphingolipid metabolism
ttt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    THITE_2109377
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    THITE_2109377
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    THITE_2109377
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     THITE_2109377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 Big_1 CARDB
Motif
Other DBs
NCBI-GeneID: 11515581
NCBI-ProteinID: XP_003650113
JGI: Thite2_2109377
UniProt: G2QV90
LinkDB All DBs
Position
1:6218407..6221100
Genome map
AA seq 897 aa AA seqDB search
MWSSSFFADAFHLALLGPLLLSVEAKPVKNDGIREKISINAGWRFSRSEFNTDKLAYDLS
RTDYANRTDLTVLKPWVMPSANDFIVDPAARYQPPSTEPNISCPFVQSSFDDSSWESVNL
PHDWAIKGPFYVGDNVPVSGGMGRLPVQGVGWYRRKLQMTEADEGKSVYLDIDGAMSYSI
VWLNGHLVGGWPYGYSSYQLDLTPHLKLGDDNLLAIRVDNPGNSSRWYPGGGIYRNVWLT
KTSPTHVGQWGTFITSKNVSKSSAVLDLTVEVENSGNASQTLSVVTDVYVLDTATGAAGR
QVASFPRQTVTVAGGQKASVNASTTVNKPALWGPPPSQSPNMHVAVTRLYNRHNDVVDTY
STNFGIRSVVYDSNHGLLVNGELIRIRGVNGHHDLGSLGAAFNERAAQRQLEVLQELGCN
ALRTSHNPPAPELLDLADKMGILVYEEAFDCWQLGKNPNDFHLIFDEWSEADVRTMLRRD
RNHPSVIIWSIGNEVGEQTTGATGAAVAKRLREIVHSEDVTRPVTASMNAARPDMPFPGE
LDLVSLNYQGEGIRDTGPYAGLPGISTSPLYYAFHDAFPDKLVLSSETAATLSTRGTYFF
PVTNWTSAPENYTLGSGGNDTLLEVSDYGLYTAPFGSSPDKVFVAQDNASFVGGEFVWSG
WDYIGEPTPYYEARSSYYGIIDLAGFGKDRFFEYQSRWRPDLPVAHILPHWTWPDRVGQV
TPVHVFSNGDEAELWVNGRSQGRLRRASASVYRFRWDNVTYHAGEVRVVAYKNGKPWASD
RVVTAGAPAALRLSADRSAISGDGLDLSFLTATVVDGKGNVVPAADNEITFSVSGGGGEL
VATDNGDPRDFTSFASATRKAFSGRALAVVRANGQGAITVTASSAGLARAVVRLTAH
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcctcaagctttttcgcagacgcctttcatctcgcccttctaggcccactgctg
ctgtccgtcgaggcgaagccggttaagaatgatggaatacgcgagaaaatcagcatcaac
gccggctggcgcttctcaaggagcgagttcaacacagacaagctggcctacgatctcagc
cgcaccgactacgccaaccgcaccgacttaaccgtgttgaaaccgtgggttatgccgtca
gcaaatgacttcatcgtcgacccggctgcacgataccagcccccctccaccgaaccgaac
atcagctgcccctttgtgcagtcgagcttcgacgactcctcgtgggagagtgtcaacctg
ccgcacgactgggccatcaaaggtccgttctacgtcggggacaatgttcccgtcagcggc
ggtatggggcgcctgcccgtccaaggcgtcggttggtaccgccgaaagttgcaaatgacc
gaggccgacgagggcaagtccgtctacctcgacatcgacggcgccatgtcgtactccatc
gtctggctcaacggccacctcgtggggggctggccctacggatactcgtcctaccagctc
gacctcacgccgcacctcaagctaggtgacgacaacctgctggccatccgcgtcgacaat
cccggaaactcgtcacgctggtaccccggcggaggcatctaccgcaatgtctggctcacc
aagacgagcccgacgcacgttggccagtggggcaccttcatcacatcgaagaacgtgtcc
aagtcatccgcagtcctcgatctgacggtcgaggtcgaaaactcgggtaacgcctctcag
acgctgagtgtggtgaccgacgtgtacgtccttgacacagcgacgggggcggccggcagg
caggtagcctcgttcccgcgccagaccgtcaccgtggcagggggccagaaggcctcggtc
aatgcttcgacgactgtcaacaagccagcgctgtggggtccgccgccctcgcagtcgccg
aatatgcatgtcgccgtaacacgtttatataaccgccacaacgatgtcgtcgacacttac
tcgacgaattttggcattcgctcggttgtttatgactcaaaccacggcttgctggtcaac
ggcgagctgatcagaatcaggggcgtgaacggccaccacgatctcggctcgctgggagct
gccttcaacgagcgtgcggcccaacggcagctcgaggtgctccaggagctgggttgcaat
gctctccgcacttcgcacaaccccccggcccccgaactgctggacctggccgataagatg
ggcatcctggtctacgaggaggcttttgactgctggcagctgggcaagaacccgaacgac
ttccacctcatcttcgacgaatggtctgaggccgacgtgcgcactatgctgcgccgggac
cgtaaccacccgtccgtcatcatctggagcatcggcaacgaggtcggggagcagaccacc
ggcgctaccggcgctgccgtcgccaagcggctacgcgaaatcgttcactccgaggatgtg
acgcgccccgtgacggcatccatgaatgcggcgcgcccggacatgccattcccaggcgag
cttgatctggtcagcctcaactaccaaggcgagggcattcgcgacaccggcccgtacgcc
ggcctgcctggcatcagcacatcgccgctctactacgccttccacgacgccttcccggac
aagttggtcctcagcagcgagacggcggcgaccctgagcacccgaggcacctacttcttc
cccgtcaccaactggaccagcgcgcccgagaactacacgctcggaagcggcggcaacgac
acgctgctcgaagtgagcgactacggcctgtacacagccccgttcgggtcgtcgcccgac
aaggtcttcgtcgcgcaggacaacgcgtccttcgtgggcggggagttcgtctggtccggg
tgggactacatcggcgagccgacgccgtactacgaggcgcgcagctcgtactacggcatc
atcgacctggccggcttcggcaaggaccgcttcttcgagtaccagtcgcgctggcggccc
gacctccccgtcgcgcacatcctgccgcactggacctggccggaccgcgtcggccaggtc
acgcccgtgcacgtcttctccaacggcgacgaggccgagctgtgggtcaacggccggtcg
cagggccggctgcgccgcgcgtccgcgtccgtctaccgcttccgctgggacaacgtcacc
taccacgcgggcgaggtgcgcgtggtcgcgtacaagaacggcaagccgtgggccagcgac
cgggtcgtgacggcgggcgcgcccgcagcgctgcgcctgagcgccgaccggtccgccatc
agcggcgacgggctcgacctgtcgttcttgacggccacggttgtggacggcaagggcaac
gtcgtgccggcggcggataatgagatcacgttctccgtgtctggcggcggcggcgagctc
gtggccacggacaacggcgatccccgggacttcacctcgtttgcgtccgcgacgcgcaag
gcctttagcgggcgagcgttggcggtcgtgcgtgctaatggccagggggccatcacggtc
acggccagctcggccggccttgctcgtgcggtggtcaggttaacggcacattga

DBGET integrated database retrieval system