KEGG   Thielavia terrestris: THITE_2109783Help
Entry
THITE_2109783     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
ttt  Thielavia terrestris
Pathway
ttt00220  Arginine biosynthesis
ttt00250  Alanine, aspartate and glutamate metabolism
ttt01100  Metabolic pathways
ttt01200  Carbon metabolism
ttt01210  2-Oxocarboxylic acid metabolism
ttt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    THITE_2109783
   00220 Arginine biosynthesis
    THITE_2109783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ttt01007]
    THITE_2109783
Enzymes [BR:ttt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     THITE_2109783
Amino acid related enzymes [BR:ttt01007]
 Aminotransferase (transaminase)
  Class I
   THITE_2109783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 11523721
NCBI-ProteinID: XP_003650393
JGI: Thite2_2109783
UniProt: G2QXZ0
LinkDB All DBs
Position
1:join(7219713..7220121,7220183..7221234)
Genome map
AA seq 486 aa AA seqDB search
MASSTSRRRLNLDNINPHVRAAKYAVRGELAVRSEEYRASLLSGATDLPFKEVISANIGN
PQQLDQKPITFFRQVLSILENPALLEKGDVLVNHLGYKPDVLERAKRLLDQVGSVGAYSA
SNGAPAIRQSVAEFLERRDGFPANQADIYLSAGASSGVNTLLHIICAGEKSGVLIPIPQY
PLYTASLSVLNATAVPYYLDESKNWGTDLGTIKAAHEKAKAEGIDVRAIVIINPGNPTGA
SLPEEHIRAVIEFARQERLVILADEVYQTNVFIGEFISFKRMLRQMQKEKPGVYDDIELA
SLHSVSKGMVGECGHRGGYFELVGFDPAVQAEIYKFVSIMLCAPVIGQCLVELMVNPPKP
GEPSYPLYKQEYDAIFNGLRERATALHKAFQQMEGVECGEPQGSMYLFPTIKLPAKAAAA
AAAEGRTPDEFYCMRLLEATGVCVVPGSGFGQKEGTLHFRTTFLPPGTEWVGSIVKFHKE
FMDKYR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctccacctcgcgtcggcgactcaacctcgacaacatcaacccccacgtcagg
gctgccaagtatgccgtgcgcggtgagctggccgtccgatctgaggagtaccgtgcctcg
ctgctcagtggcgcgaccgacttgcccttcaaggaggtcatctcggcaaacatcggcaac
ccccagcagctcgaccagaaacccatcaccttcttccgccaggtcctcagcatccttgag
aacccggccctgctcgagaagggcgatgtcctggtgaaccacctgggctacaagcccgac
gtgttggagcgggctaagaggttgcttgatcaggtcggctccgtgggtgcctacagtgcc
agcaacggcgctcccgccatccgccagagtgtcgccgagtttttggagagacgtgatggg
ttccccgctaatcaggccgacatctacctctcggctggtgcttcttcgggtgtcaacact
cttctgcacatcatctgcgccggcgagaagtcgggtgtcctgattccgatcccgcagtac
cctctgtacacggcttccctctctgtcctcaacgccaccgctgtgccgtactacctggac
gagtccaagaactggggcactgacctgggcaccataaaggcggcccacgagaaagccaag
gctgagggcattgacgtgcgcgccatcgtcatcatcaaccccggcaacccgacgggtgct
tcgctgcctgaagaacacatccgcgccgtgatcgagttcgcgcgccaggagcgccttgtc
atcctcgccgacgaggtctaccagaccaacgtcttcatcggcgagttcatcagcttcaag
cgcatgctgcgccagatgcagaaggagaagcccggcgtctacgacgacatcgagctcgcc
tccctgcactcggtgtccaagggcatggtgggcgagtgcggccaccggggcggctacttc
gagctcgtcggcttcgacccggccgtgcaggccgagatctacaagttcgtctccatcatg
ctctgcgcccccgtcatcggccagtgcctcgtcgagctcatggtcaacccgccgaagccg
ggcgagcccagctacccgctctacaagcaggagtacgacgccatcttcaacggcctgcgc
gagcgcgccaccgccctgcacaaggccttccagcagatggagggcgtcgagtgcggcgag
ccccagggctccatgtacctcttcccgaccatcaagctgcccgccaaggccgccgccgcc
gccgccgccgagggccgcaccccggacgagttctactgcatgcgcctgctcgaggccacc
ggcgtgtgtgtcgtgcccggctccggcttcggccagaaggagggcaccctgcacttccgc
accaccttcctcccccccggcaccgagtgggtcggcagcatcgtcaagttccacaaggag
ttcatggataagtaccgctga

DBGET integrated database retrieval system