KEGG   Thermothielavioides terrestris: THITE_2113980Help
Entry
THITE_2113980     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ttt  Thermothielavioides terrestris
Pathway
ttt03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    THITE_2113980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttt03400]
    THITE_2113980
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     THITE_2113980
DNA repair and recombination proteins [BR:ttt03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     THITE_2113980
 Prokaryotic type
     THITE_2113980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG CDC27
Motif
Other DBs
NCBI-GeneID: 11514947
NCBI-ProteinID: XP_003652462
JGI: Thite2_2113980
UniProt: G2R4T6
LinkDB All DBs
Position
2:complement(join(4758545..4759424,4759516..4759883))
Genome map
AA seq 415 aa AA seqDB search
MSALKRKAGAEAGAEPKKAKQGSIMTFFGAPKPSSTASIASNSATSVPEPATPKFDKAKW
AASLTPEQRQLLQLEIDTLHESWLALLKDELVTKEFLELKRFLDRETAAGRKWFPPKEDI
YSWSRHTPFNTVKVVILGQDPYHNHNQAHGLAFSVRPPTPAPGSLRNMYTALKADYPAFN
PPPNRGGLLTPWADRGVLMLNTCLTVRAHEANSHSNRGWERFTQRVIDLVAARRSRGVVF
MAWGTPAGKRVLKVDTKRHLVLKSVHPSPLSAAKGFFTCRHFRLANDWLAERYGPDGRVD
WALNEGESVFADEGKTTTTVGAVAVGSAAGKVLEVESVKKEADGEGEGKEETTAKVEGEV
VEGGVLKQIEAVVRASVAGGDKDAGAKEVETLLEKKAAAVEAGGEDENTAPEIGP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctctcaagcgcaaggccggcgccgaggccggggcggagccgaagaaagccaag
cagggcagcatcatgacctttttcggcgcacccaagccctcgtcgaccgccagcattgca
agcaacagtgcgacttctgtcccggagcccgcgactcccaagttcgacaaggccaaatgg
gctgcttccctgacccccgagcagcggcagctgctccaactcgagattgacaccctgcac
gagagctggctggccctgctcaaggacgagctcgtcaccaaggagttcctcgagctcaag
aggttcctcgaccgcgagaccgccgccggcaggaagtggttcccgcccaaggaagacatc
tacagctggtcccgccacacgcccttcaacaccgtcaaggtcgtcatcctcggccaagac
ccctaccacaaccacaaccaggcgcacggcctcgccttctccgtccgcccgcccaccccc
gccccgggctcgctcaggaacatgtacacggcgctcaaggcggactacccggccttcaac
ccgccgccgaaccggggcggcctgctgacgccgtgggccgaccgcggcgtgctgatgctc
aacacgtgcctgaccgtgcgcgcgcacgaggccaactcgcactcgaaccgcggctgggag
cgcttcacgcagcgcgtcatcgacctcgtcgccgcgcgccgctcccgcggcgtcgtcttc
atggcctggggcacgcccgcggggaagagggtcctcaaggtcgacaccaagaggcacctc
gtgctcaagagcgtgcacccctccccgctgtctgccgccaagggcttcttcacctgccgc
catttccggttggccaatgactggcttgcggagaggtacgggcccgacggcagggtggat
tgggcgttgaacgagggcgagagcgtgtttgccgatgaggggaagacgacgacgacggtg
ggcgcggtcgctgtcggaagcgcagcggggaaggtgttggaggttgaatcggtgaagaag
gaggcggacggggaaggggagggaaaggaggagacgacggcgaaggtggaaggggaggta
gtggaggggggcgtgctgaaacagatcgaggcagtggtgagggcttcggtcgctggcggg
gacaaggatgcgggtgccaaggaggtggagacgctgcttgagaagaaggcggcggctgtc
gaggcaggcggggaggatgagaataccgcgcctgagattgggccttga

DBGET integrated database retrieval system