KEGG   Thermothielavioides terrestris: THITE_2116896Help
Entry
THITE_2116896     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
Organism
ttt  Thermothielavioides terrestris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 DAO NAD_binding_8 FAD_oxidored GIDA HI0933_like Pyr_redox_2 FAD_binding_3 Thi4 Pyr_redox_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 11519012
NCBI-ProteinID: XP_003654143
JGI: Thite2_2116896
UniProt: G2R798
LinkDB All DBs
Position
3:complement(1631295..1632773)
Genome map
AA seq 492 aa AA seqDB search
MASTHPPPVIVVGAGLAGLSAAYSALQAGAPSVRLLERAAKPGGNSIKASSGINGAPTRF
QDVAKHGVDQSFCEDTVKSAGSRLHASVAESVRKQRQDLISVLTSRSASAIDFLVDLGVD
LSVVAQLGGHSKPRTHRGAGKTPPGASIVTTLLAKLKEHEGRFELVTEAEVTKLLLTANN
QVTGVEYRKDGASHSLAGPVVFATGGFGGDTHGLLARYRPDLDGLPSTNDPRPGAHDLLA
AGAGAALVDMESVQVHPTGFVDPAAPRAPLKFLAAEVLRGEGGILLHRGRRIVNELATRD
KISGVIMDLPLPDAEGEGEDGAGGLRQWDVQLLLDPGTAEAAAGHVGFYLWKGLLQKKKV
ADLDEATRETLREYAAVVRGEKPDEFGRTAFGHWTLGADGSGIAEDAEVCVGRVTPIVHF
TMGGVVFNEQAQVLSSALGEAQKPIQGLWAAGEITGGIHGDNRLGGSSLLECVVFGRIAG
EQAAQSVLKAEA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcacgcatccgccccccgtcattgtggttggtgccggcctcgctgggctttcg
gcggcctactcggcactccaggcgggggccccctctgtccggcttctcgaacgagccgcc
aagccgggaggcaacagcatcaaggcttcgtccggaatcaacggggccccgacgaggttc
caagacgtagccaagcatggcgtcgaccagagcttctgtgaagatacggtcaagtcagcc
gggtctcgactccacgcctccgtggcggaatccgtgagaaagcagcggcaggacctcatc
tcggtcttgaccagccgctcggcctccgccatcgacttcctcgtagacctcggcgtcgac
ctcagcgtcgtggcgcagctcggcggacacagcaagcctcgcacgcaccggggggccgga
aaaacgccgcccggcgcctccatcgtgaccacgctacttgccaagctgaaagaacacgag
ggccgcttcgaactcgtcaccgaagccgaagtcaccaagctgctgctcacggccaacaac
caagtgaccggcgtcgagtaccgcaaagacggcgccagccactccctcgcgggccccgtc
gtcttcgccacaggcggcttcggcggcgacacgcacggcctgctggcccggtaccgcccg
gacctcgacggcctgccgtcgaccaacgacccgcggcccggcgcgcacgacctgctcgcc
gccggcgccggcgccgccctcgtcgacatggagagcgtgcaggtgcacccgaccggcttc
gtcgacccggccgcgccgcgggcgccgctcaagttcctcgccgccgaggtgctccgcggc
gaagggggcatcctcctgcaccgcggccggcggatcgtcaacgagctggccacgcgggac
aagatcagcggtgttatcatggacttgcccctgcccgatgcggagggagagggcgaggac
ggcgcgggtgggctgcgccagtgggatgtgcagctgttgctggaccccgggaccgccgag
gctgcggcggggcatgtcgggttctatctgtggaaggggctgctgcagaagaagaaggta
gccgatctggacgaggctacgagggagacgctgcgggagtatgctgcggttgtgcgcggg
gagaagccggatgagttcgggcggactgcgtttgggcactggacactgggcgctgatggc
tcggggattgccgaagatgctgaggtatgcgtcggccgcgtaacgcccattgtgcacttt
accatgggcggtgtcgtcttcaacgagcaggcgcaggtgctctcatcggcactgggcgag
gcgcagaagccgattcaggggctctgggcggctggcgagattacgggaggaatccacggg
gacaaccggttgggcgggtcgtcgctgctggagtgtgtcgtgttcgggcgcattgccgga
gagcaagctgcgcagtcggtattgaaggcagaggcctga

DBGET integrated database retrieval system