KEGG   Thielavia terrestris: THITE_2117395Help
Entry
THITE_2117395     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ttt  Thielavia terrestris
Pathway
ttt00250  Alanine, aspartate and glutamate metabolism
ttt00410  beta-Alanine metabolism
ttt00430  Taurine and hypotaurine metabolism
ttt00650  Butanoate metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
Module
ttt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    THITE_2117395
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    THITE_2117395
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    THITE_2117395
   00430 Taurine and hypotaurine metabolism
    THITE_2117395
Enzymes [BR:ttt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     THITE_2117395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 11516424
NCBI-ProteinID: XP_003654401
JGI: Thite2_2117395
UniProt: G2R806
LinkDB All DBs
Position
3:join(2880488..2880541,2880606..2880896,2880968..2881012,2881082..2881319,2881506..2882521)
Genome map
AA seq 547 aa AA seqDB search
MNGVHDGQPLNRADEVEHLIDAVKALILPFIRAADEAVPSRAAGELLPNKEGVVQNALVN
ARKPEDLVRELSLCLPEGPGLGEDGLLRAIGDILKYSVNTWDQGFMDKLYASTNPVGVVS
ELLLGVLNTNVHVYQVSPALTVIEKHTAQKLARLFGFTGPRAGGITCQGGSSSNLTSIVI
ARNTLYPESKTRGNQCATGSFILFTSEHGHYSVEKAAVTCGLGSSSVWTVPVDDAGRMDP
SALRRLVQRARAEGNTPLYVNATAGTTVLGSYDPIEAVAAVCREFGLWLHVDASWGGPAI
FSPRHRHKLAGAHLANSLTVNPHKMLNVPVTCSFLLGPDTAVFHRANTLPAGYLFHSTAS
SAPNPPQPATTITTTTTPTTATPPTPAENGEEDGPPEEEVWDLADLTLQCGRRADSLKLF
LAWTYHGAGGFAAQVDRGFAAAARLAELVAAHPDLAPVSPSPPPCLQVCFYYAPRGELAA
DPAENTRRTRAVVHALVGRGFMVDYAPGKRGAFLRVVVNSLTLRGTVEGLVKAVAAVGRE
VVGGFLN
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggtccacgacggccagcccctgaacagggcagacgaggtcgagcacctcatt
gacgccgtgaaagccctcatccttcccttcatccgggcggctgatgaggccgttccatca
agggccgctggagaactgcttcctaacaaggagggagttgtccagaatgccctggtcaac
gcgcggaaacccgaggatctagttcgcgagctatccctttgcctgccggaagggccgggg
ctcggcgaggacgggctgctccgggcgatcggggatattctcaagtacagtgtcaacacg
tgggaccagggcttcatggacaagctgtatgccagcaccaacccagttggcgtcgtctcc
gagctgcttctcggcgtcttgaacacaaacgtgcatgtctaccaagtttcgccagccctg
accgtcatagaaaagcacacggcccagaagctggccaggctcttcggcttcaccggcccg
cgcgcaggcggcattacgtgccagggcggcagctcgtccaacctgacgtccatcgtcatc
gcgcgcaacacgctgtacccggagagcaagacccggggcaaccagtgcgccacgggttcc
tttatcctcttcaccagcgagcacggccactactcggtcgagaaagccgccgtgacatgc
gggctggggtcgtcgtccgtctggacggtccccgtcgacgacgcaggacgcatggatccc
tccgcgctgcggcggctcgtgcagcgcgcgcgtgcggagggcaacacgccgttgtacgtc
aacgcgacggctggcacgaccgtgctgggctcgtacgacccgatcgaggccgtcgcggcc
gtgtgccgcgagttcggcctgtggctgcacgtcgatgcgagctggggcggcccggccatc
ttctcgccgcgccaccgccacaagctcgccggcgcccacctcgccaactcgctgaccgtc
aacccgcacaagatgctcaacgtgcccgtcacctgctccttcctgctcggcccggacacc
gccgtcttccaccgcgccaacaccctcccggccggctacctcttccactcaaccgccagc
agcgcacccaacccgccccaaccggcaacaaccatcaccaccaccaccaccccaaccaca
gccacccccccaacccctgcagaaaacggggaggaggacggcccacccgaagaagaagtc
tgggacctagccgacctaaccctccaatgcggccgacgagccgacagcctcaagctgttc
ctggcctggacgtaccacggcgcgggggggttcgcggcgcaggtggaccggggcttcgcc
gcggccgcgcgcctggccgagctggtggccgcgcatccggacctggcgcccgtgtcgccc
agcccgccgccgtgcctgcaggtgtgcttctactacgcgccgcggggcgagctggcggcg
gacccggcggagaatacgcggcgcacgcgggcggtggtgcatgcgctggttgggaggggg
tttatggttgattacgcgcctgggaagaggggggcgttcttgagggtggtggtgaattcc
ttgacgttgagggggacggtggaggggttggtgaaggctgtggcggcggtggggagggag
gttgttggggggtttttaaactag

DBGET integrated database retrieval system