KEGG   Thielavia terrestris: THITE_2117766Help
Entry
THITE_2117766     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ttt  Thielavia terrestris
Pathway
ttt03030  DNA replication
ttt03410  Base excision repair
ttt03420  Nucleotide excision repair
ttt03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    THITE_2117766
   03410 Base excision repair
    THITE_2117766
   03420 Nucleotide excision repair
    THITE_2117766
   03430 Mismatch repair
    THITE_2117766
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttt03032]
    THITE_2117766
   03400 DNA repair and recombination proteins [BR:ttt03400]
    THITE_2117766
Enzymes [BR:ttt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     THITE_2117766
    6.5.1.6  DNA ligase (ATP or NAD+)
     THITE_2117766
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     THITE_2117766
DNA replication proteins [BR:ttt03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    THITE_2117766
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     THITE_2117766
DNA repair and recombination proteins [BR:ttt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     THITE_2117766
   NER (nucleotide excision repair)
    Other NER factors
     THITE_2117766
   MMR (mismatch excision repair)
    Other MMR factors
     THITE_2117766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 11518690
NCBI-ProteinID: XP_003654641
JGI: Thite2_2117766
UniProt: G2R5L3
LinkDB All DBs
Position
3:complement(join(3738508..3740148,3740194..3741198))
Genome map
AA seq 881 aa AA seqDB search
MASPTKKRKLNSDSKQKTAPTKGLEYFFEKQRRNGSSSSTPPVPEHDAKPEQSQGSLTDE
ELARKLQAEWDAEVRAASVPAAAQPGTGGSGMTKAASEPESATTPQPPEAPLASPGIGST
RTKKPLLLSSAAATEDQATASIPLDESPLTFDPAKYVPELQNSWASEGGDASYALLTRCF
VLVNGTQSRIKIVDTLVNCMRLLIVGDPASLLPAVWLSTNAISPPYISMELGIGGSALSK
ALKQACGLDNRALKSLYDKLGDPGDVAFEAKKKQSFTLRKPKPLTIKGVFQSLVKIAKSQ
GQGSGEVKQRIVDRLLQDARGGEESRYIVRTLCQHLRIGAVKTTMLIALSRAFLLSRPAG
AGFPVKDPRELAKLKKDELAEVWTRAEELVKASYARHPDYNDLIPVLLEIGVSEELLVRC
GLTLHIPLRPMLGSITRDLSEMLTKLQGRDFACEYKYDGQRAQVHCDANGKVSIFSRHLE
LMTDKYPDLVALVPKIRGDGVESFILEGEVVAVDRATGELRNFQTLTNRARKDVAIGSIT
IDVCLFAFDLMYLNGQSLLDQPFRHRRDLLRSLFVEIPHHFTWVKNLDATSQDSEAVLEF
FKSALDSKCEGIMVKTLDNFAELETTGEDASEDRSASEPPAAKPTPQSRKSKRTTPPEAH
MSLQQPAPPTKSRRKPLLATYEPDKRLESWLKVKKDYHASTADTLDLVPIAAWHGQGRKA
KWWSPILLAVRNDETGCLEAVCKCMSGFTDAFYKANRAFYDDGSGGGGEARNTHARKPPF
VEYDGPAPDVWFEPCEVWEVAFADVTLSPTYTAAIGLVSEERGLSLRFPRFLRKREDKGV
EEASTSGFLAGLWRKQEAKVSTAVGEEAAAGVGGEEDEDEE
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctacgaaaaagaggaagttgaactctgattcgaagcaaaagactgcccca
acaaaagggctagagtacttcttcgagaagcagagacgtaatggttcctcgtcgagcact
ccacctgttccagagcacgatgcgaagccggagcagtcccaaggctccttgacggacgaa
gagcttgcgagaaaacttcaagctgagtgggatgccgaggttagggccgcctcggtcccc
gctgcagcccagccggggacagggggctccgggatgaccaaagcagcttcggagccagag
tcggcaacgactccccagccgccggaagcaccgcttgcctccccaggaattggatcgaca
cgcacaaagaagccccttctgctgtcttctgcagcggcaacagaagaccaggcgaccgct
tccatcccgttggatgaaagcccactgaccttcgacccggcgaagtatgtccctgagcta
caaaactcctgggcttctgagggtggagatgcatcttacgccttgctcacgcgatgtttc
gttttggtcaacggcactcagagccggatcaaaatcgtcgacacgcttgtcaactgtatg
cggttgctgatcgtgggcgatcctgcgagtctcctgccggccgtctggctgtctaccaac
gccatatcccctccctacatatccatggagctcggaattggcgggtctgccctctccaag
gcactcaagcaggcatgtgggctggacaaccgggcgctgaagtcactgtatgacaaactt
ggggaccctggcgatgttgctttcgaggccaagaagaaacagagcttcactttgcgcaag
ccgaagccgctcacaattaaaggcgtcttccagtctttggtcaagatcgcaaaaagtcag
gggcaggggagcggtgaggtgaaacagcggattgtcgacagacttctgcaagacgcgcgc
ggaggggaggagagccgatacatcgttaggacgctctgtcaacatctacggatcggtgcc
gtcaagactacgatgttgatcgctctgtcccgcgcgttcttgctttctagacctgccggc
gccggctttccggtcaaggatccgcgggaactcgctaagctcaagaaggatgagctggct
gaggtctggaccagggcagaagagctcgtcaaagcttcctacgcgcgacatcctgactac
aacgacctcattcccgtgcttctggaaatcggcgtctccgaggagttgctcgtgcgctgc
ggtcttacgctccacattccgttgcggccgatgctgggaagcatcacccgcgatctgtcg
gagatgctcaccaagctgcaaggccgtgactttgcctgcgaatacaagtatgacggacag
cgagctcaagtccactgtgacgccaatggcaaagtctcgatcttttcgaggcatctggaa
ctcatgacagacaagtacccagatctggttgcccttgtccccaaaatccgaggcgacggt
gttgagagttttatcctggagggcgaggtggttgctgtcgaccgtgccactggcgaactg
aggaacttccagacactcactaatcgtgcccgaaaggacgttgctattgggagcattact
attgatgtctgtctcttcgcgttcgatctcatgtacctcaacggacagtcgctgttggac
caacctttccggcatcggcgggatctgcttcggtctcttttcgtcgagatcccccaccac
ttcacatgggtcaaaaatctcgacgcgacgtcgcaagattccgaggcggttctcgagttc
tttaagtccgccctcgacagcaagtgcgaggggatcatggtcaagacgctcgacaatttt
gccgagctcgaaaccacgggcgaagatgcctccgaagaccgctcagcatccgaaccgcca
gccgcaaaaccaaccccccaatcccgcaagtcgaaacggaccacaccccccgaagcgcac
atgtcactccaacaaccagcgcccccaaccaaatcccgccgcaagccgctcctagcaacc
tacgaacccgacaagcgcctcgagtcctggctcaaagtcaaaaaagactaccacgcctcc
accgcggacacgctcgacctggtacccatcgccgcctggcacggccagggccgcaaggcc
aagtggtggtcgcccatcctgctggcggtccgcaacgacgagaccggctgcctcgaggcg
gtgtgcaagtgcatgtccggcttcacggacgccttctacaaggcgaaccgggcgttctac
gacgacggcagcggcggcggcggcgaggcgcgcaacacgcacgcgcgcaagcccccgttt
gtcgagtacgacggtcccgcgccggacgtgtggtttgagccgtgcgaggtgtgggaggtc
gcgtttgccgacgttacgctcagtccgacctacacggcggcgattgggctcgtcagcgag
gagagggggttgagcttgcggtttccgcggtttttgaggaagagggaggataaaggggtc
gaggaggccagtacgagtgggttcttggccgggctgtggaggaagcaggaggcgaaggtg
tctacggcggtgggggaggaggcagcagctggggtgggaggggaggaagacgaggacgag
gaatga

DBGET integrated database retrieval system