KEGG   Thermothielavioides terrestris: THITE_2121452
Entry
THITE_2121452     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
Organism
ttt  Thermothielavioides terrestris
SSDB
Motif
Pfam: Kelch_1 Kelch_3 Kelch_6 Kelch_4 Kelch_5 Kelch_2
Other DBs
NCBI-GeneID: 11522563
NCBI-ProteinID: XP_003656594
JGI: Thite2_2121452
UniProt: G2REX5
LinkDB
Position
5:1718029..1719708
AA seq 559 aa
MADQARAAGRDRQPQPQPSQNIKVVRSQKIATASLSPTDTRPPASSELYDDAAEAGDRAP
PIPRSHTPGHLSSRSQDRRNRPADIAIRHRSQSSAAAINSTPSSSSGRAPSLSSSASSFS
IPTTKTPAPISTRQPSIAEEADGTTAPSGERHDSSTGSGSKGPAPPRPTAMRSTSAIAGR
SAPGAAGPAGAVARIGTGRGAPAKGAEVYTPFPPLADPKTAPDVPPAPSSGMYWSRAPVS
GAPHTALRAHTTTLVGSNVFIFGGCDARACFNELYVLDADAFYWSTPHVVGDVPVPLRAM
TCTAVGKKLVVFGGGDGPAYYNDVYVLDTVNFRWSRPRILGDRAPSKRRAHTACLYKNGI
YVFGGGDGVRALNDIWRLDVSDVTKMSWKLISPPADGRSPGGGAGKDDRPKARGYHTANM
VGSKLIIYGGSDGGECFNDVWVYDVETHVWKAVHIPVTFRRLSHTATIVGSYLFVIGGHD
GNEYSNDVLLLNLVTMTWDKRKVYGLPPSGRGYHGTVLHDSRLLVIGGFDGSEVFGDVWL
LELAVHAYYSQISHFTIEV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggctgaccaggccagagctgcggggcgcgacaggcagccgcagccgcagccgtcgcag
aacatcaaggtcgtgcggtcgcaaaagattgcgacagcctcactgtcgcccaccgacacg
cgtccgccggcctcctccgagctctatgacgacgcagccgaagctggggaccgcgctccg
ccgataccgcggtcgcatacgcctggccatctctcgtcccggagccaggaccgccgcaac
aggcccgccgacatagccatccgccaccgctcgcaatcctccgccgcagccatcaactct
acgccctcctcgtcgtccgggagggcgccctccctctcctcctcggcctcctccttctct
atccccaccacgaagacccccgcaccgatttcgacccggcaaccgagcatagctgaggag
gcagatggtactaccgcccccagcggggaacggcatgattcgtccacaggcagcggcagc
aaaggacctgcgccgccgcgaccgaccgcgatgcgctccacatccgccatcgcgggccgg
tccgcacccggggcggcaggtcccgccggcgccgttgcgcgcatcggaaccggacggggg
gcgcccgcgaagggggccgaagtgtacacgccgttcccgccgctggcggaccccaagacg
gcccccgacgtgccccccgcgccgtcgtccggcatgtactggagcagggcgcccgtgtcc
ggggcgccgcacacggcgctgcgcgcgcacacgaccacgctggtggggtccaacgtgttc
atattcggcgggtgcgacgcgcgcgcctgcttcaacgagctgtacgtgctggacgccgac
gccttctactggtcgacgccgcacgtggtaggcgacgtgccggtgccgctgcgcgccatg
acgtgcaccgccgtgggcaagaagctggtcgtcttcggcggcggcgacgggccggcctac
tacaacgacgtgtacgtgctcgacacggtcaacttccgctggtcgcggccgcgcatcctg
ggcgaccgggcgccgtccaagcgcagggcgcacacggcgtgcctgtacaagaacggcatc
tacgtgttcggcggcggcgacggcgtgcgcgcgctcaacgacatctggcgcctcgacgtc
agcgacgtcaccaagatgtcgtggaagctcatctcgccgccggccgacggccggtcgccc
ggcggcggtgccggcaaggacgaccggcccaaggcgcgcggctaccacacggccaacatg
gtcggcagcaagctgatcatctacggcggctcggacggcggcgagtgcttcaacgacgtg
tgggtctacgacgtcgagacgcacgtctggaaggccgtccacattccggtcaccttccgg
cggctgtcgcacacggccaccatcgtcggctcctacctcttcgtcatcggcggccacgac
ggcaacgagtactccaacgacgtcctgctgctcaacctggtcaccatgacctgggacaag
cgcaaggtgtacggcctgcccccgagcggcaggggctaccacggcaccgtcctgcacgac
agccgcctgttggtcatcggcggcttcgacggcagcgaggtgtttggcgacgtctggctt
ctggagctcgccgtccatgcgtattattcgcagatcagccacttcactatcgaggtgtga

DBGET integrated database retrieval system