KEGG   Thermothielavioides terrestris: THITE_2122060Help
Entry
THITE_2122060     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
Organism
ttt  Thermothielavioides terrestris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Cyt-b5 DAO FAD_oxidored NAD_binding_8 Pyr_redox_2 HI0933_like Pyr_redox_3 GIDA Thi4 FAD_binding_3 Amino_oxidase AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 11519340
NCBI-ProteinID: XP_003656843
JGI: Thite2_2122060
UniProt: G2RFM4
LinkDB All DBs
Position
5:join(2539937..2539970,2540080..2540386,2540454..2541984)
Genome map
AA seq 623 aa AA seqDB search
MAPRVIVVGGGLSGLSAAHTIYINGGNVVVLDKQGFFGGNSTKATSGINGALTRTQIEQG
IQDSVQQFYNDTLKSARDQARPDLIKVLTYKSAAAVEWLQDVFNLDLTLVSRLGGHSQPR
THRGHDAKFPGMAITYALMQRLEELAESEPHRVQIIKKARVTSLNKEGNTITGVKYEHNG
ETLSLDGPVVLATGGYAADFGEGSLLKQHRPDTLGLATTNGSHATGDGQKMVMAIGGNGI
DLDKVQVHPTGLVDPKDPGSKWKFLAAEALRGEGGILLNADGDRFCDELGHRDYVSGMMW
KEKDKGKFPIRLVLNSKASNTLDFHTRHYSGRGLMKKMSGHQLAKEIGCTPEHLQQTFQT
YNAIAEGKQKDPWGKRFFHNMPLDINDTFHVSLMEPVLHFTMGGIEINDKAQVLNKEKKP
FEGLFACGELAGGVHGANRLGGSSLLGCVVYGRVAGDSASNYLFQQVLKGSSTSAARLGQ
IALHIDPSTPGKISVEWTGASGGTSGGAEAPKAQPAPVSPSAPKQQTQTKDTKSFSIPDK
EYTMEEVAKHNKKDDLWVVVKGVVLDLTNWLDDHPGGPQALLNFMGRDATEEFEMLHDDE
VIPKYAPSQVIGRVKGQKVTLEI
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccagagttattgttgttggcggcggtctgtccggcctcagcgcagcgcacacc
atctacatcaacggcggcaacgtcgttgtcctggataagcagggcttctttggcggcaac
tcgacaaaggccacctccggcatcaacggcgccctcacaaggacacagattgagcagggc
atccaggacagcgtgcagcagttctacaatgacacgctcaagtcggcccgtgaccaggcg
cggcccgacctcatcaaggtcttgacctacaagtctgcggccgctgtcgagtggctgcag
gatgtgttcaatctcgacctcacgctcgtttcccggttgggtggccattcgcagccccgt
acccaccgtggccacgatgccaagttccctggcatggccatcacctacgctctgatgcag
cggctggaggagctcgccgagagcgagccccaccgcgttcagatcatcaagaaggcccgc
gtcaccagcctcaacaaggagggtaataccatcaccggtgtcaagtacgagcacaacggc
gagaccctgtcgctcgacggccctgtggtgctcgccaccggcggttacgcggccgacttc
ggcgagggctcgctgctcaagcagcaccgcccggataccttaggcctggccaccaccaac
ggctcgcacgccaccggtgacggccagaagatggtcatggccattggcggcaacgggatc
gacctggacaaggtgcaggtccaccctaccggcctcgtcgaccccaaggaccccggctcc
aagtggaagttccttgctgccgaggccctccgtggtgagggcggcattcttctgaacgcc
gacggcgaccgcttctgcgacgagctcggccatcgcgactacgtctcgggcatgatgtgg
aaggagaaggacaagggcaagttccccattcgcctggtcctcaactccaaggcgtccaac
acgctcgacttccacacccgccattactcgggccgtggcctcatgaagaagatgtcgggc
caccagctcgccaaggagatcggctgcactcccgagcaccttcagcagaccttccagacc
tacaacgccatcgccgagggcaagcagaaggacccgtggggcaagcgcttcttccacaac
atgccgctggacatcaacgacacgttccacgtctccctgatggagcccgtgctccacttc
accatgggtggtatcgagatcaacgacaaggcccaggttctcaacaaggagaagaagccc
ttcgagggcctcttcgcctgcggcgagctggctggcggtgttcacggcgccaatcgtctg
ggcggctcctcgttgctgggctgcgtcgtctatggccgtgtcgccggtgactctgccagc
aactacctcttccagcaggtgctcaagggctcctcgaccagcgcggcccgccttggccag
atcgccctgcacattgacccctcgactccgggcaagatctcggtcgagtggaccggtgcc
agcggcggtaccagcggcggtgccgaggcgcccaaagcgcagcccgcgccggtcagcccg
tctgcccccaagcagcagacgcagaccaaggacaccaagtcgttctccatccctgacaag
gagtacaccatggaggaggtcgccaagcacaacaagaaggatgacctctgggttgttgtc
aagggcgtcgtgctcgaccttaccaactggctcgacgaccacccgggcggccctcaggcg
ctgctcaacttcatgggccgcgacgccaccgaggagttcgagatgctccacgacgacgag
gtcatccccaagtatgcgccctcgcaggtcatcgggcgggtcaagggtcagaaggttacg
ctggaaatttga

DBGET integrated database retrieval system