KEGG   Thielavia terrestris: THITE_2122075Help
Entry
THITE_2122075     CDS       T02228                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ttt  Thielavia terrestris
Pathway
ttt00052  Galactose metabolism
ttt00500  Starch and sucrose metabolism
ttt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    THITE_2122075
   00500 Starch and sucrose metabolism
    THITE_2122075
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     THITE_2122075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7 Gal_mutarotas_2 7tm_3
Motif
Other DBs
NCBI-GeneID: 11519343
NCBI-ProteinID: XP_003656846
JGI: Thite2_2122075
UniProt: G2RFM7
LinkDB All DBs
Position
5:join(2579298..2579492,2579634..2580714,2580770..2581216,2581283..2581546,2581604..2581695,2581801..2581830,2581887..2583119,2583209..2583454)
Genome map
AA seq 1195 aa AA seqDB search
MEPAASPTRAARPLAVKHKGRFPGSRPFPSRDTNTYTSTSSAEITSYPAWPPRRSVVGIR
GCTGLVQSAAPKSKSPPPLWRSSSTATLVQSVLILVGGIATAFAEGTGILDVTLDAEEQD
VQLQEGPDAYIGEPTKLDQVGRAPQHSGTWILGLGIYIPLGLFLLLFLFALTYSFKRRSR
IPRSKATGSSRFIQSAIAMFSFTLLLWITGFCLRAASGDYDHSAVSRTSWQPNQTVAPAP
VFTIPASATLGRNVLPNIIDPEAVDPQTVCPGYKASNIDETEGGFTAELDLAGPACNVYG
NDIEHLSLSVDFQADDRVHVDIRPRFISPENESWFLLPEVLVPRPPRGARYQQSDSALIV
SWSNDPTFSFSVKRRETNDTLFSTEGKVLVYEDQFVEFASALPERYNLYGLGEVIHGFRL
GDNLTRTLFAADVGDTIDANLYGSHPIYLDTRYFVADDSGELTYVQNTTDKANKYVSYTH
GVFLRNAHAQEILLRPSSVTWRTLGGSIDLYFYSGPKAQDVIRAYQQTAVGLPAMQQYWS
LGFHQCRWGYKSWAEVEDVVDNFARFEIPLETIWTDIDYMKQYRDFENDPVRFGYTEGSK
FLAKLHANHQHYVPIIDSAIYAPNPENPDDAYPPYDRGVEAKAFMLNPDGSIYYGAVWPG
YTVFPDWVGAVLDGGGAIDWWIDEILRYSKKVAFDGIWIDMSEVSSFCVGSCGTGNLTLN
PAHPPFELPGEPGNLVLQYPEGFNSTNSSEAMSASSASRQQEAATATTQAPTSTSYYRTT
PTSGARNVNWPPYVINNSNGELAGHAVSPNATHHGGYLEYDVHNLFGHMILNATYQALLK
VHEGKRPFIIGRSTFAGSGKWAGHWGGDNAALWAYMYFSIPQALSFSIFGIPMFGVDTCG
FAGNTDYELCSRWMQLSAFFPFYRNHNILGAISQEPYVWSSVAEATKTAMRIRYSLLPYM
YTLMARASLEGSTVMRALAWEFPAEPWLADADRQFMLGSALMVTPCLEQGASTVGVVFPG
VGDGTVWYDWYTLAAVKGVEPGQNVTIDAPLGHIPLYLRGGNVVPTQEPGMTTTESRRNP
WGLIVALDRDGSAEGELYLDDGESLEPDAVTWVHFSATNNSVAARPEGNYVDTNRLANVT
VLGLPEAPSMVWLNGNLLATSRWSYSADSAVLSVQGLHDLSPEGAWAAAWELTWE
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgcagcatcgccgactcgagccgcccgacctttagcggtcaagcataagggc
cggttccccggatcgagaccgtttcccagccgggacacaaacacatacacaagtacaagc
tcggccgagatcacttcataccccgcatggcctcctcgccgatccgtcgtcgggatccgc
ggttgtaccggtcttgttcagtccgccgctcccaagtctaagtcaccgccgccgttatgg
cgctcctcatcaacggccaccctcgttcagtccgtgttgattttagtcggtggcatcgcg
acagccttcgcggaaggaaccggcattcttgacgtcactttggacgcggaggaacaggac
gtgcagctgcaggaagggcccgacgcatacatcggagaaccaacaaagctcgatcaggtt
ggccgggcaccgcagcactccggcacatggattctggggctaggaatttatatcccgctc
ggcctcttccttttgttgttcctctttgctctcacctactcgttcaagcggcgctcacga
ataccaaggtcaaaagctacgggatcctcccggttcatacaatccgccatcgcaatgttc
tccttcacgttgctattgtggattactgggttctgtctcagggccgcttcgggtgactac
gatcattcagccgtctcgcggacatcgtggcagccgaatcagactgttgcccccgccccc
gtctttaccattccagcttctgccaccttgggccggaacgtcttgcccaacatcatcgat
cccgaagcagtcgacccccagactgtttgcccgggctacaaggcctccaacatcgacgag
accgagggtggcttcacggcggaattggacctcgctggacctgcgtgcaacgtctatgga
aacgacattgagcacctttctctgtctgtcgacttccaagccgatgatcgtgttcatgtc
gatatccggccccgtttcatcagcccggaaaacgagagctggttcctccttccggaggtg
ctcgtcccgcggcctcctcgcggtgctcggtatcagcaatccgactccgccttgattgtg
tcctggtcgaacgaccctaccttctccttctccgtcaagcgcagagagacgaatgacact
ctcttctcgacggaagggaaggttctcgtttatgaggaccaattcgtcgaattcgcgtct
gcgctccccgagcgctacaatctgtacggcctcggcgaagtcatccatggcttccgcctt
ggcgataatttgacgagaactttgttcgctgccgacgtcggggacaccatcgacgcgaac
ctctacggcagccatccgatctatcttgacacgagatatttcgttgctgacgactcgggt
gagttgacctatgtccagaacacgacggacaaggcgaacaagtacgtctcgtacacgcat
ggcgtgttcctccggaacgcccatgcgcaggagatcctcctgcgaccgtcgagcgtcacg
tggaggacgctgggcgggagcattgacttgtacttctacagtggtccgaaggcacaggac
gtcatccgagcctaccagcagaccgcagtcggattgcccgccatgcagcagtactggtcc
cttggcttccaccagtgccgctggggatacaagagttgggcagaggtggaggacgtcgtc
gacaattttgccagattcgagataccactggagacgatctggaccgacatcgattacatg
aagcagtaccgagactttgagaatgatccggtgcgcttcgggtacaccgaaggctccaag
tttctcgcaaagcttcatgccaaccatcagcattacgttccgatcatcgactccgccatc
tatgcccccaatcccgagaatccggacgatgcctaccctccatatgatcgcggagttgag
gccaaggcctttatgttgaatccagatggctccatatactacggagccgtttggcctggc
tatacagtatttcccgactgggtgggagctgtgcttgatggcggcggggcgatcgactgg
tggattgacgagatattgaggtattcgaagaaggtggcttttgacgggatatggatcgac
atgtccgaggtttcgtcattttgcgtcggaagctgtggaaccgggaacttgacgctgaac
ccagcccatccgcctttcgagttacccggagagccgggcaatctggtgctgcaatacccg
gagggcttcaactccacaaactcgtccgaagcgatgtcggcctcgtctgcatcgcgccag
caggaggcagcgacagcaactacgcaggccccgacctcgacgtcttattaccgcaccacg
ccaacgtcgggagcgaggaacgtgaactggccgccttacgtgattaacaacagcaacggc
gagctggcagggcatgcggtgagccccaacgcaacgcaccatggcggctaccttgagtac
gacgtgcacaacctgttcggccacatgatcctcaacgccacgtaccaagccctgctgaag
gtgcacgagggcaaacggcctttcatcatcgggcgcagcacattcgccggctccgggaaa
tgggcagggcactggggaggcgacaatgccgccctttgggcgtacatgtacttcagcatc
ccacaggccttgtcgttctccatcttcggcatccccatgttcggcgtcgacacctgcggg
ttcgccggcaacaccgactacgagctgtgctcgcggtggatgcagctcagcgcctttttc
cccttctacaggaaccacaacatcctcggcgccatcagccaggagccgtacgtctggagc
agtgttgccgaggcgaccaagacggccatgcgcattcggtactcgctgctcccctacatg
tacacgctcatggcgcgggcgagtctggagggcagcaccgtgatgcgggcattggcgtgg
gagttccccgccgagccttggcttgcagatgcggaccggcagttcatgctgggcagcgcc
ctcatggtcaccccgtgcttggagcagggcgcctcgaccgtcggcgtcgtgttccccggc
gtcggcgacggcaccgtctggtacgactggtacaccctggcggccgtcaagggggttgag
cctggccagaacgttacaattgacgccccgctcggccatatcccgctgtatctgcgcggc
ggcaacgtggtccccacccaggagccgggaatgaccaccacggagagccgcaggaatccg
tgggggctcattgtggcgctggatagggacggctcggccgagggtgagctttacctggac
gacggcgagagcttggaaccggacgctgtgacgtgggtgcatttctccgccacgaacaac
tcggtcgctgcgcggccggaaggcaactacgtcgacaccaaccgcctcgcgaatgtcacc
gtcttggggctccccgaggctccctcgatggtctggttgaatgggaatctgcttgcgacc
tcgcgctggagctactccgcagatagcgccgtcctgtccgtgcaggggctgcatgacctg
tccccggaaggggcctgggcggcggcgtgggaacttacgtgggagtag

DBGET integrated database retrieval system