KEGG   Thielavia terrestris: THITE_2124124Help
Entry
THITE_2124124     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ttt  Thielavia terrestris
Pathway
ttt00020  Citrate cycle (TCA cycle)
ttt00310  Lysine degradation
ttt00380  Tryptophan metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
ttt01130  Biosynthesis of antibiotics
ttt01200  Carbon metabolism
Module
ttt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THITE_2124124
  09105 Amino acid metabolism
   00310 Lysine degradation
    THITE_2124124
   00380 Tryptophan metabolism
    THITE_2124124
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     THITE_2124124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N YceG_bac
Motif
Other DBs
NCBI-GeneID: 11522149
NCBI-ProteinID: XP_003657913
JGI: Thite2_2124124
UniProt: G2RIB5
LinkDB All DBs
Position
6:complement(join(2126130..2126671,2126768..2129354))
Genome map
AA seq 1042 aa AA seqDB search
MLRTSLRALQGAAASSSSRCFSTATLSARAALRLAANRRPLAVGAQKRFESALHNPPDPN
DSFLQGNTANYIDEMYLQWKQDPKSVHVSWQVYFKNMESGEMPISQAFTPPPSLVPSTQA
VVGLAAGAGVGIGEGADITNHLKVQLLVRAYQARGHHKSKIDPLGIRNASKGFGNIRPKE
LELDYYQFTEKDLDTEYTLGPGILPRFKRDGREKMTLREIIAACEKIYCGSYGVEFIHIP
DREKCDWLRERLEVPQPFKYSIDEKRRILDRLIWSSSFEAFLATKYPNDKRFGLEGCESL
VPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAGAEDEGSGD
VKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKVRAIQHYNNDETTHRSAMAV
LLHGDAAFAAQGVVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAYCTDIAK
AIDAPVFHVNADDVEAVNFVCQLASDWRAEFKQDVIIDLVCYRKHGHNETDQPSFTQPLM
YKRIQEKKSQIDIYVDQLLKEGTFTKEDIEEHKQWVWGMLEESFSKSKDYQPTSKEWTTS
AWNGFKSPKELATEVLPHNPTGVDRKTLEHIGEVIGRAPEGFNLHRNLKRILANRTKSVL
EGKNIDWSTAEALAFGSMVTEGRHVRVSGQDVERGTFSQRHAVFHDQETEDTYTPLQHIS
KDQGKFVISNSSLSEYGALGFEYGYSLTDPNGFVMWEAQFGDFANNAQCIIDQFIASGEQ
KWVQRTGLVMSLPHGYDGQGPEHSSGRLERFLQLCNEDSRVFPSPEKLHRQHQDCNMQVA
YMTTPANLFHILRRQMNRQFRKPLILFFSKALLRHPLARSNIEEFTGDSQFRWIIPDPAH
ESGEIKAPEEIDRVILCSGQVYAALHKYRADHKIDDVAFTRIEQLHPFPWEQLRENLDRY
PNAKTIVWAQEEPLNAGAWSYTQPRIETLLNQTKYHDRKHVMYAGRNPSASVATGLKASH
KKEEEDLLEMAFTVKQDKLKGE
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcacttcgctccgggcgctgcagggcgccgcggcgtcgtcgtcgtcacgatgc
ttctcgacagccaccctctcggcgcgcgccgccctgcggctcgctgccaaccgccgtccc
ctcgccgtcggtgcccaaaaacgcttcgagagcgcactccacaacccgcccgacccgaac
gacagcttcctccaggggaacacggccaactatatcgacgagatgtacctgcagtggaag
caggaccctaagagcgtccacgtgtcgtggcaggtctacttcaagaacatggagagcggc
gagatgcccatctcgcaggccttcaccccgcccccgtccctcgtgcccagcacccaggct
gtcgttggcctcgccgctggcgccggtgtcggcattggcgagggcgccgacatcaccaac
catctcaaggtccagctcctcgtgcgcgcctaccaggcccgcggccaccacaagtccaag
atcgatcccctgggcatccgcaatgcctccaagggcttcggcaacatccggccgaaggag
ctcgagctcgactactaccaattcaccgagaaggacctggacaccgagtacaccctgggc
cccggcatcctgccgcgtttcaagcgcgacggccgcgagaagatgaccctccgcgagatc
atcgccgcctgcgagaagatctactgcggctcctacggcgtcgagttcatccacatcccc
gacagggagaagtgcgactggctgcgcgagcgtctcgaggtgccgcagcccttcaagtac
tccatcgacgagaagcgccgcatcctcgaccgcctgatctggagctccagcttcgaggcc
ttcctggccaccaagtaccccaacgacaagaggttcggcctggaaggctgcgagagcttg
gtgcccggcatgaaggcgctcatcgaccgcagcgtcgactacggcgtcaaggacatcgtc
atcggcatgccccaccgcggccgtctgaacgtgctgagcaacgtcgtcaggaaacccaac
gagtccatcttcagcgagttcgccggtactgccggcgccgaggacgagggctccggcgac
gtcaagtaccacctgggcatgaactttgagcgcccgaccccctccggaaagcgcgtgcag
ctgtccctggtggccaacccgtcgcatctcgaggccgaggaccccgtcgtcctcggcaag
gtccgcgccatccagcactacaacaacgacgagaccacccaccgcagcgccatggccgtg
ctgttgcacggcgatgccgccttcgctgcccagggcgtcgtctacgagtgtctcggcttc
cactcgctgccggccttctcgactggcggcacgatccatctcgtggttaacaaccagatc
ggcttcaccacggatccccgcttcgcccgctcgaccgcctactgcaccgacatcgccaag
gcgatcgacgcccctgtcttccacgtcaacgccgacgacgtcgaggctgtcaacttcgtc
tgccagttggcctccgactggcgcgccgagttcaagcaggatgtcatcatcgacctggtc
tgctaccgcaagcacggccacaacgagaccgaccagccgtccttcacccagccgctcatg
tacaagcgcatccaggagaagaaatcgcagatcgacatctacgtcgaccagctcctgaag
gagggcaccttcaccaaggaggacatcgaggagcacaagcagtgggtgtggggcatgctg
gaggagagcttctccaagtccaaggactaccagccgacctccaaggagtggaccaccagc
gcctggaacggcttcaagtcgcccaaggagctggccaccgaggtgctgccgcacaacccg
accggcgtcgaccggaagactctggagcacatcggcgaggtcatcggccgcgcgcccgag
ggcttcaacctgcaccgcaacctgaagcgcatcctcgccaaccggaccaagtcggtcctc
gagggcaagaacatcgactggtcgaccgccgaggcgctggccttcggcagcatggtgacc
gagggccgccacgtccgcgtttccggccaggacgtcgagcgcggcaccttctcgcagcgc
cacgccgtcttccacgaccaggagaccgaggacacgtacacgccgctccagcacatcagc
aaggaccagggcaagtttgtcatctccaactcgtcgctcagcgagtacggcgctctcggc
ttcgagtacggctactcgctgacggaccccaacggcttcgtcatgtgggaggcccagttc
ggcgactttgccaacaacgcgcagtgcatcatcgaccagttcatcgcctccggcgagcaa
aagtgggtgcagcgcaccggcctggtcatgtcgctgccccacggctacgacggccagggt
cccgagcactcgtccggccgcctggagcgcttcctccagctctgcaacgaggattctcgc
gtcttcccctcgcccgagaagctgcaccgccagcaccaggactgcaacatgcaggttgcc
tacatgaccacgcccgccaacctgttccacatcctccgccgccagatgaaccggcaattc
cggaagcccctcatcctgttcttctctaaggcgctgctccgccacccgctggcccgctcc
aacatcgaggagttcaccggcgactcgcaattccggtggatcatccccgacccggcgcac
gagtcgggcgagatcaaggcgcccgaggagatcgaccgggtcatcctgtgctcgggccag
gtgtacgcggcgctgcacaagtaccgcgccgaccacaagatcgacgacgtcgccttcacg
cgcatcgagcagctccaccccttcccgtgggagcagctgcgcgagaacctggaccggtac
cccaacgccaagaccatcgtctgggcccaggaggagccgctcaacgcgggcgcctggagc
tacacgcagccgcgcatcgagacgctgctcaaccagaccaagtaccacgaccgcaagcat
gtcatgtacgccggccgcaacccgagcgcgtccgtggccaccggcctgaaggcgtcgcac
aagaaggaggaggaggacctgttggaaatggccttcaccgtgaagcaggacaagctgaag
ggcgagtag

DBGET integrated database retrieval system