KEGG   Thielavia terrestris: THITE_2142959Help
Entry
THITE_2142959     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ttt  Thielavia terrestris
Pathway
ttt04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    THITE_2142959
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     THITE_2142959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 11518642
NCBI-ProteinID: XP_003651529
JGI: Thite2_2142959
UniProt: G2R451
LinkDB All DBs
Position
2:complement(join(1368302..1368324,1368387..1368483,1368548..1368699,1368775..1368954,1369225..1369237))
Genome map
AA seq 154 aa AA seqDB search
MVKAVAVVRGDSKVTGTVTFEQESESSPTIVSWDISGHDPNAKRGMHIHAFGDNTNGCTS
AGPHFNPHGKTHGAPTDENRHVGDLGNIETDAQGNSKGSVSDKLIKLIGPESVIGRTVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgctgtcgtccggggtgactcgaaggtcacgggcactgtcaccttc
gagcaggagtccgagtcgtcccctaccatcgtgtcctgggatatctcgggccacgacccc
aacgccaagcgtggcatgcacatccacgccttcggcgacaacaccaacggctgcacgtcg
gctgggccacacttcaacccccacggcaagacgcacggcgcgcccacggatgagaaccgt
cacgttggcgacctgggcaacatcgagaccgacgcccagggcaactccaagggctccgtg
agcgacaagctcatcaagctcatcggccccgagagcgtcattggccggaccgtcgtcgtc
catgccggcactgacgaccttggcaagggcggcaacgaggagtcgctgaagaccggcaac
gccggcccccgccctgcctgcggtgtcatcggtattgcgcagtaa

DBGET integrated database retrieval system