KEGG   Thielavia terrestris: THITE_50690Help
Entry
THITE_50690       CDS       T02228                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ttt  Thielavia terrestris
Pathway
ttt00500  Starch and sucrose metabolism
ttt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THITE_50690
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     THITE_50690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 11522959
NCBI-ProteinID: XP_003657679
JGI: Thite2_50690
UniProt: G2RHN1
LinkDB All DBs
Position
6:complement(join(1373255..1373310,1373377..1374468,1374528..1374659,1374715..1374788,1374847..1375216,1375275..1375524))
Genome map
AA seq 657 aa AA seqDB search
MHAFSSLLVLGACAVQAVLGRPEADPRARREGALLQRFVDSFISSETSVAWSKLLCNVGP
DGCAAAGAASGVVVASPSKSNPDYWYTWTRDAALVLTGVVDSLARNYSATLQSAIQNYVV
AQAKLQEVSNPSGSLADGAGLGEPKFMVDLTPFSGQWGRPQRDGPALRAIALARYAKWLI
GNGYASTAKDVVWPVIKNDLAYIAQYWNETGFDLWEEVPCSSFFTIASNHRALVEGAALA
AQLGTECRACITAAPHILCFQQTFWKADGGYVVSNINTGTARTGKDVNSVLASIHTFDPA
VGCDATTFQPCSDKALSNHKAYVDSFRSLYPINAGIPQGRAVAVGRYAEDVYFNGNPWYL
ANFATAEQLYDAIYVWKKQGSITVTPLSLTFFQDLVPSLAAGTYPSSSQTYQAILSAVSA
YADDFMAVAAKYTPADGSLAEQYDRATGAPTSAADLTWSYAAFLSAADRRAGIVPTPGWS
AAAAHGPTLPSTCARVQVAGSYAPATAAASSASPFPPSQTPNPTATPPAAPAPLPSGCCA
AADAATVYVAFHARVATRWGEAVRVVGSAPELGAWDPVRAVPLSASAYSAADPLWSITVP
ISAGADAAGRTVLYKYVKVQPDGSVVWESDPDRRLVLAVGSGEVVPCPAQTVNGTWR
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccttctcgtccctgctcgttctgggtgcgtgcgccgtccaggccgtcctcgga
cgccccgaagccgatccccgcgctaggcgggagggcgccctgctccagcggttcgtcgac
tcgttcatcagcagcgagacgtccgtcgcttggagcaagctgctctgcaatgtcggcccc
gacggctgcgcggcggccggtgctgcgtcgggcgtcgtggttgcgagcccctccaagtcc
aacccggactactggtacacgtggaccagagacgctgccctcgttctcacgggcgtcgtg
gactcgctcgcccgcaactactcggccaccttgcagagcgccattcagaactacgttgtc
gcccaggccaagctccaggaggtctcaaacccctcgggcagcctcgccgacggcgctggt
ctcggcgagcccaaattcatggtcgacctgacgccgttctccggccagtggggccggccc
caaagggacggccctgctctgcgggctatcgcgctcgcccggtatgccaagtggctgatt
ggcaacggctacgcctcaacggccaaggacgtagtctggcccgtgatcaagaacgatctg
gcttacattgcccagtactggaacgagacaggcttcgatctctgggaagaggttccctgc
agctcgttcttcaccattgccagcaaccacagggctctcgtcgagggcgctgctcttgcc
gcccagctgggcaccgaatgccgcgcctgcatcactgctgccccacacatcctatgcttt
cagcagaccttttggaaggctgatggcggctacgttgtctccaacatcaacaccggcacg
gctcggactggcaaggacgtcaactctgtcctggcatcgatccacacctttgatccggcc
gtgggctgcgacgccacgacgttccagccatgcagcgacaaggccctgtcgaaccacaag
gcctacgtcgactcgttccgctccctctatcccatcaatgcgggcatcccccaaggcagg
gccgtcgccgtgggccgatacgccgaagacgtctacttcaacggcaacccgtggtacctc
gccaatttcgcgacggccgagcagctctacgacgccatctacgtctggaagaaacaaggc
tccatcaccgtgaccccgctctcgctgaccttcttccaagacctcgtcccctcgctcgca
gccggcacctacccctcgtcctcccagacctaccaagccatcctctccgccgtctccgcc
tacgccgacgacttcatggccgtcgcagccaagtacacccccgcggacggctctctagcc
gagcaatacgaccgcgccaccggcgcgcccacctccgccgccgacctgacctggtcgtac
gcggccttcctctccgccgccgaccgccgcgcgggcatcgtccccacgccaggctggtcg
gccgcggccgcccacggcccaaccctcccgagcacctgcgcccgcgtccaagtcgcgggc
agctacgcccccgccaccgccgcggcgtcctccgcctcccccttcccgcccagccagacc
cccaacccgaccgcgacccccccggctgctcccgcacctttaccctcgggctgctgcgcc
gccgcggacgcggcgaccgtctacgtcgcgttccacgcgcgcgtggcgacccgctggggc
gaggcggtgagggtggtcggcagcgcgccggagctcggcgcgtgggacccggtgcgcgca
gtgccgctgtctgcgtccgcgtactcggccgcggatccgctgtggagcatcaccgtgccg
atatcagcgggcgcagacgcggcgggccggacggtgctgtataagtatgtcaaggtgcag
ccggatgggagcgtggtgtgggagtcggatccggatcgcaggttggttctggctgttgga
agtggggaggtagtgccgtgcccggcgcagacggtgaatggtacttggcggtag

DBGET integrated database retrieval system