KEGG   Thielavia terrestris: THITE_52603Help
Entry
THITE_52603       CDS       T02228                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ttt  Thielavia terrestris
Pathway
ttt00052  Galactose metabolism
ttt00500  Starch and sucrose metabolism
ttt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    THITE_52603
   00500 Starch and sucrose metabolism
    THITE_52603
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     THITE_52603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 11518847
NCBI-ProteinID: XP_003654681
JGI: Thite2_52603
UniProt: G2R5Q4
LinkDB All DBs
Position
3:join(3947988..3948195,3948256..3950591)
Genome map
AA seq 847 aa AA seqDB search
MAFKFILAALSATAALAQLSEPATQCRGYRATNVVQGDSYLSADLVLIANCSVFSKDVEK
LKLLVEYQTDTRLHVLIEDADEQVYQIQDRVLPRPKSQNTPANKAALKFNFTQNPFTFKV
IRASNGDILFDTSSSPLNFESQYVRLRTNLPQNPYLYGLGEHSDDFRLPTVGYTRTLWNA
DGAFLPTRSNLYGSHPVYFEHRGNSGTHGVFLLNANGMDVRIDQTDSGQQYLEYNTLGGV
LDLYFLAGPEPASVSKQYAEVVGLPAAMPYWTFGFHQCKYGWPNIDHVAEVVANYSAAGI
PLETVWGDIDYMDAHRDFTVDPNRFPLDKVRALVDSLHSNNQHYIQILDPGISRNGSYGP
YARGEQKGAFLRVADGSDYRGMQWAGQVVWPDWFSPAAQDWWTSEIQAFYDPKTGIDVDG
LWNDMNEVSNFCGDTNCFNSQSTAASLPRRPVSRYTRRASPAPKLGLPGRDLFNPKYRIN
NHLGAIYASTLWTNITNADGSRQYDTHNLYGSMMASASRAALLARRPNKRPFVLTRSSFA
GVGRAAAHWFGDNASTWEHYRTSIRQMLAFAAMHAVPMVGSDVCGFNGVAEQYMCARWAL
LGAFQPFYRNHADITAPDQEFYRWPIVAAAARKAIDVRYRLLDYIYTAVWRASVDGTPAI
NPLWFWYPGDEATWTVQTQWGLGDSLLISPVVDENSTSVTFYLPKDVWYDFWTGEKVVSA
GETKTMGTLDFTDIPVHIRGGSILALRSKSANTTAELRKQNFALTVAPGSDGTAKGFLYL
DDGESLDVGNAKSEITFKWDGSVLTAEGTFGYHTDLVIESVTVLGQGEAKKALAKPLSLS
KGFTFRP
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaagtttatcctcgcggcgctgtccgcgactgcggccctcgcgcaactctcg
gagcctgccacccagtgccgtggctaccgagcgaccaatgttgtccaaggcgactcttac
ctgtccgcagacctcgtgctgatcgccaactgcagcgtgttcagcaaggatgtagagaag
ctgaagctgctcgtcgaatatcagaccgacacccgactgcatgttttgatcgaggatgcc
gacgagcaggtgtatcagatccaggatcgggtgctgccgcgacccaagagccagaacacc
ccggccaacaaggcggcgctgaagttcaacttcacccagaatccttttacctttaaggtg
atccgggcgtcaaacggcgacattttgttcgacacttccagctcgccgctgaattttgag
tcgcagtatgtccggctccggaccaatctgccgcagaacccgtacctctacgggctcggc
gagcactcggacgacttccgcctgccgaccgtgggctacacgcgcacgctctggaatgcc
gacggggccttccttcccacccgatccaacctgtacgggagccacccggtgtactttgag
caccgcggcaactcaggcacacacggcgtgtttctgctcaacgccaacgggatggatgtc
cgcatcgaccagacggactcgggacagcagtatctggagtacaacaccctgggcggcgtc
ctcgacttgtacttcctggccggccccgagcccgcatccgtcagcaagcagtatgccgaa
gtcgtgggtctgcccgccgcgatgccctactggacgtttggtttccaccagtgcaagtac
ggctggccgaacatcgaccacgtcgccgaagtggtggccaactactcggccgccggcatc
ccgctggagaccgtctggggggacatcgactacatggacgctcaccgcgatttcaccgtg
gatcccaatcggtttcccctggataaggtgcgtgcactggtcgactcgctgcacagcaac
aaccagcactacatccagattctcgacccgggaatcagccggaacggtagctacggcccg
tacgcccggggcgagcagaagggcgcgttcctccgcgtcgccgatggctcggactaccgc
ggcatgcagtgggccggccaggtcgtgtggcctgactggttctcccccgccgctcaagac
tggtggacgtcggaaatccaagccttttacgacccgaagaccggcatcgacgtcgacggc
ctctggaacgacatgaacgaggtgtcgaacttctgcggcgacacaaactgcttcaattcc
caatccaccgccgcttcactccctcggaggcctgtctcgcggtacacccgccgcgcctcc
cccgcgcccaagctcggcctcccgggccgcgacctcttcaacccgaagtaccgcatcaac
aaccatctcggtgccatctacgccagcacgctctggaccaacatcaccaacgccgacggc
tcccgccagtacgacacgcacaacctgtacggctcgatgatggcgtcggcgtctcgcgcg
gccctgctggcccggcggccgaacaaacggccattcgtgctgacgcggtcgtcgttcgcg
ggcgtggggcgcgcggcggcgcactggttcggcgacaacgcgtcgacgtgggagcactac
cgcacgtcgatccggcagatgctggcgttcgcggcgatgcacgccgtgcccatggtcggc
tccgacgtgtgcggcttcaacggcgtcgccgagcagtacatgtgcgcccgctgggccctg
ctcggcgccttccagcccttctaccgcaaccacgccgacatcaccgcccccgaccaggag
ttctaccgctggcccatcgtcgccgccgccgcgcgcaaggccatcgatgtgcgctaccgc
ttgctggactacatatataccgccgtgtggcgggccagcgttgacggcacgccggcgatc
aacccgctgtggttctggtaccccggcgatgaggcgacgtggacggtgcagacgcagtgg
gggctgggagactcgctgctgatcagcccggtcgtggacgagaatagcacgtcggtgacc
ttctatctgccgaaggatgtgtggtacgacttctggactggggagaaggtggtgagcgcc
ggagagacgaagacgatgggcacgctcgacttcaccgatatcccggtgcatatccggggt
ggcagcatcttggccctgcggtcgaagtcggccaacaccacggcagagctgcgcaaacag
aactttgccctcacggtggcgccgggctcggatggcactgccaaggggttcctgtacctc
gatgacggcgagagcttggacgtcggcaacgccaagtccgagatcaccttcaagtgggat
ggatcggttctcacggccgagggcacattcgggtatcacaccgacctcgtgatcgagagc
gtgacggtgctcgggcagggggaggcgaagaaggccctggcgaaacctttgagcttgagc
aagggatttacatttcgcccttag

DBGET integrated database retrieval system