KEGG   Thermothielavioides terrestris: THITE_61645
Entry
THITE_61645       CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ttt  Thermothielavioides terrestris
Pathway
ttt00020  Citrate cycle (TCA cycle)
ttt00190  Oxidative phosphorylation
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
ttt01200  Carbon metabolism
Module
ttt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ttt_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THITE_61645
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    THITE_61645
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     THITE_61645
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Other DBs
NCBI-GeneID: 11522581
NCBI-ProteinID: XP_003656612
JGI: Thite2_61645
UniProt: G2REZ3
LinkDB
Position
5:complement(join(1780873..1781092,1781216..1782439,1782503..1782831,1782907..1782980,1783060..1783114,1783230..1783274))
AA seq 648 aa
MASSMAWRRLAAAPALSRAFRNPTRAFSTTRPVARVIANGPLRAKEASPFVSNKYPVIDH
EYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPASIIELEHYGCPFSRTEDGKIYQRAFGGQSQKY
GKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLIMQDGECRGVLAYNQE
DGTLHRFFANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPE
KDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGE
VLTVDEQGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFTPGA
PLKPVEADAGAQSIETLDKIRTSNGPKSTAEIRLAMQKTMQREVSVFRTQESLDEGVRQI
TEVDKMFSQVGIKDRSMIWNSDLVETLELRNLLTCATQTAVSAANRKESRGAHAREDYPE
RDDENWMKHTLSWQKTPHGPVELKYRRVISTTLDENECKPVPPFKRVY
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggcatcctcaatggcttggagacgactagccgcggcgccggcgctctcgcgtgccttc
cggaacccgacccgcgccttttccacaacacgaccggtcgcccgcgtcatcgccaacggg
ccgctccgcgcgaaggaggcgtcgccattcgtcagcaacaaatacccggtcatcgaccac
gagtacgatgcgatcgtcgtcggtgccggcggcgccggtctgcgtgccgccttcggtctg
gccgaggccggcttcaacacggcctgcatttccaagctgttccccacgagaagtcacaca
gtcgccgcccagggcggcatcaacgccgcgctcggtaacatgcacgaggacgactggaga
tggcacatgtacgacacggtcaagggctccgactggctcggcgaccaggatgccatccac
tacatgacccgcgaggctcccgcctccattattgaactcgagcactatggctgccccttc
tccagaaccgaggatggcaagatctaccagcgtgccttcggtggtcagtcccagaagtac
ggcaagggcggccaggcttaccgctgctgcgccgccgccgaccgtaccggccacgctctc
ctccacacgctctacggccagtccctccggcacaacaccaactacttcatcgagtacttc
gccatcgacctgatcatgcaggatggcgagtgccgcggtgtgctggcctacaaccaggag
gacggcacgctccaccgcttcttcgcaaacaacactgtcctggccaccggcggctacggc
cgtgcctatttcagctgcacctctgcccacacctgcacgggtgacggcatggccatggtt
gcccgcgctggcctgcccaaccaggatctcgagttcgtgcagttccacccgaccggcatc
tacggcgccggctgcctgatcaccgagggcgctcgtggtgagggtggctacctgctcaac
tcggagggtgagcgctttatggagcggtacgcgccgaccgccaaggatctggccagccgt
gacgtcgtctcgcgctccatgaccttggagatccgcgagggccgcggtgtcggccccgag
aaggaccacatctacctccagctcagccatctccccgccgagatccttgccgagcgtctc
ccgggtatctcggagactgccggcatcttcgcgggcgtcgatgtccgcaagcagcccatt
cccgtcctgcccaccgtccactacaacatgggcggtatcccgacgcggtacactggcgag
gttcttaccgtggacgagcagggcaacgacaaggtcgttcccggactctttgcttgcggc
gaggcggcctgcgtctcggtccacggcgcgaaccgcctgggcgccaactcgctcctcgac
ctggtcgtcttcggccgtgccgtctcgcacacgatccgcgacaaattcacgcccggcgct
cccctgaagccggtcgaggccgacgcgggcgcccagtcgatcgagacgctcgacaagatc
cgcacctcgaacggccccaagagcaccgccgagatccgcctggccatgcaaaagaccatg
cagcgggaagtcagcgtgttccgcacgcaggagagcttggacgagggtgtccggcagatc
accgaggtcgacaagatgttctcgcaggtcggcatcaaggaccggagcatgatctggaac
tcggacctcgtcgagacgctcgagctccgcaatctgctcacttgcgccacgcagaccgcc
gtctcggccgccaaccgcaaggagtcgcgcggcgcgcacgcccgcgaggactacccggag
cgcgacgacgagaactggatgaagcacacgctcagctggcagaagacgccccacggcccg
gtcgagctcaagtaccgccgcgtcatcagcacgacgctcgacgagaacgagtgcaagccg
gtgccaccgttcaagcgtgtctactaa

DBGET integrated database retrieval system