KEGG   Teredinibacter turnerae: TERTU_0799Help
Entry
TERTU_0799        CDS       T00952                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ttu  Teredinibacter turnerae
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TERTU_0799 (ahpF)
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TERTU_0799 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 AlaDh_PNT_C Glutaredoxin NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACR14503
UniProt: C5BPI4
LinkDB All DBs
Position
840755..842341
Genome map
AA seq 528 aa AA seqDB search
MLDATLKSQLQTYLNNLQSPVELVSYADDSVKGQEVYALVKDIAELSDKVSHTEGSDSNE
RVPSMVVRSVKTGSEIRFAGVPMGHEFTSLVLALLHSGGHPIKLDADIIEQVRALEGEFR
FETYVSLSCQNCPDVVQALNMMAAINPQIHNVMIDGAVFKEEADARNILAVPAVYLNGEP
FAQGRLTLKDILQKVDKNSGKREAEKISAKAPFEVLVVGGGPAGASAAIYAARKGIRTGI
VAERFGGQVMDTMAIENFISVKATEGPKLVAGLEEHVREYDVDIMTGARVVSVTPADVVG
GYARVELSNGAHVLSRSVIVATGARWREMNVPGEKEYRGRGVAYCPHCDGPLFKGKRVAV
VGGGNSGIEAAIDLAGIVEHVTVLEFGKQLRADEVLQRKARSLPNVEIITEAQTTEVVGN
GERVTALTYTDRATDESHTLELAGVFVQIGLVPNAEFLQHTAQLTPRGELIVNERGEASE
IGLFGCGDVTNSPYKQIIIAMGSGATAALSAFDYLIRTPQPFAEQKVA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgacgcttaaatcgcaattacaaacttatttgaataacttgcagtcacct
gttgagctggtgagttatgccgacgatagtgtgaaaggccaggaagtctatgcgctggta
aaagacatcgccgagctgtctgacaaggtttcccacaccgaaggcagtgacagcaacgag
cgagtaccctcaatggtggtgcgctcggtaaaaaccggttctgaaattcgttttgctggc
gtgcctatggggcatgaatttacatcgctggtgctggcgctgctgcacagtggtgggcac
ccgattaaactggatgccgatattattgaacaagtacgtgcactggaaggcgagtttcgc
tttgaaacttacgtgtcgctttcgtgccagaactgtccggatgtagtgcaggcgctgaat
atgatggcggccattaatccacaaattcacaacgtaatgattgatggtgcagtatttaag
gaagaagcggacgcgcgcaatattctcgcggtacctgcggtttatttaaatggagagccg
tttgcccaggggcgactgacactgaaagatattttgcagaaagttgacaaaaattcaggc
aagcgcgaagcagaaaaaatatccgcgaaagcaccgtttgaagtattggtggtgggcggt
ggccctgctggcgcctcagcggcaatttacgctgcgcgaaagggcattcgcaccggcatc
gttgccgagcgttttggcggtcaggtaatggacaccatggcgatcgagaactttatttcg
gtgaaggccaccgaaggcccaaaactggtcgcgggtttggaagagcatgtgcgcgaatac
gatgtagacattatgacgggcgcccgggttgtgtcggtaacgccagcagatgtggtgggc
ggttatgcgcgtgtggaactgagcaacggcgcgcacgtgttgagtcgctcggtaatcgtt
gctaccggtgcacgttggcgcgaaatgaatgtgcctggcgaaaaagaatatcgcggccgg
ggtgtggcttattgcccacactgtgacgggccactgtttaaaggcaagcgcgttgccgtg
gtcggcggcggtaattccggtatcgaagcggcgattgatcttgctggtattgttgaacat
gttacggtgctggaatttggtaaacagctgcgcgccgatgaagttctgcaacgcaaagca
cgctctttgcccaacgtagaaattattaccgaagcgcagactaccgaagtggtgggtaat
ggcgagcgagtcaccgcgcttacctatacagaccgcgcgacagatgagtcgcacacgctt
gaactggccggtgtatttgtgcaaattgggttagtgcccaacgcagagttcttgcagcac
actgcacagctcacaccgcgtggtgagttgatcgttaatgagcgtggcgaagcgtctgaa
atcggtttgtttggttgtggcgatgtgactaacagcccgtacaagcaaattattatcgcg
atgggaagcggtgcaaccgcggcactttcggcattcgattatttgattcgcaccccgcaa
ccgtttgcagaacaaaaggtggcgtaa

DBGET integrated database retrieval system