KEGG   Teredinibacter turnerae: TERTU_1260Help
Entry
TERTU_1260        CDS       T00952                                 

Definition
(GenBank) alpha/beta hydrolase family protein
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00621  Dioxin degradation
ttu01100  Metabolic pathways
ttu01120  Microbial metabolism in diverse environments
ttu01220  Degradation of aromatic compounds
Module
ttu_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    TERTU_1260
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     TERTU_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 LIP Abhydrolase_4 FSH1 Say1_Mug180
Motif
Other DBs
NCBI-ProteinID: ACR11155
UniProt: C5BRU8
LinkDB All DBs
Position
1317452..1318321
Genome map
AA seq 289 aa AA seqDB search
MIGHSQQIEIVEISMQFESQFIQVGNIRTHYYDVGQGPVLVLVHGGGAGADSYGNWRDCI
PVFAKDYRVIAVDMVGFGKTDKPDPETFTYDQPGRNQHLSDFLDVMKLEKVNLIGNSMGG
AASIGATLLKPARTNSLVLMGSAGLPIPERPSNELMHNLNYDFTVEGMRRVIGGLASPTF
TPSEELVEYRYQLTMDPATKAALAAVNLETRKGTLNFDQELLRTIKQPVLVVNGKEDKVS
PIARANRFLELFDNSWGYIMPHCGHWAMIEQTEDFCSTVQLFLSRVTSE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgattggccattctcagcaaattgaaatcgtggagatcagcatgcaatttgagtcgcaa
tttattcaggtcggcaatattcgcacccattattatgacgtggggcaggggcctgtgctc
gtgctggtgcatggtggcggcgcgggtgccgacagttatggtaactggcgtgactgtatt
cctgtctttgccaaggattatcgcgttattgctgtggacatggttggctttggcaaaacc
gataagccagacccggaaacctttacctacgaccagccaggtcgtaatcagcatcttagt
gattttctggatgtaatgaaactggagaaggtgaacctgatcggaaattcaatgggtggg
gcggcttcaatcggcgcaactctactcaagcccgcgcgcactaacagcctggtattgatg
ggcagcgcagggcttccgattccagagcgtccgtcgaacgaactgatgcacaacctcaat
tatgattttaccgttgagggtatgcgtagggttattggcggtcttgcttcgcccacattt
acaccgtctgaagagctggtggagtaccgctatcagttgacgatggacccggcaaccaaa
gcagcgttggcggcagtgaatttggaaacccgcaaaggtactctcaacttcgatcaggaa
ttgttgcgcaccatcaagcaaccggtactcgtggtcaatgggaaagaggataaagtatcg
ccgattgctcgcgcgaatcggtttctggagttgtttgacaatagttggggctacattatg
ccgcactgtggtcactgggcgatgatcgagcagactgaagatttctgttcgactgtacag
ctttttttaagtcgggtgacaagcgaatga

DBGET integrated database retrieval system