KEGG   Teredinibacter turnerae: TERTU_1543Help
Entry
TERTU_1543        CDS       T00952                                 

Definition
(GenBank) leucine rich repeat domain protein
Organism
ttu  Teredinibacter turnerae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRV LRV_FeS HEAT HEAT_2
Motif
Other DBs
NCBI-ProteinID: ACR11969
UniProt: C5BTB6
LinkDB All DBs
Position
1602950..1603711
Genome map
AA seq 253 aa AA seqDB search
MNKPTDGNFDGPDDRTPIADCRFCSYRANLLMSGRCSPGDVCVKVDSGRQIDRFFRFNPQ
YAEVYLRDDFWERRAIAVRYSPIDALDRLIQDPDEAVRRAVAYRLPREQLFQLMDDEDRE
VRITVADRIPLEQLEKMADDRDYLVRAYVAQRLSEGRLFRFIRDPDLQVRKIIAGRLPEE
SLGLMASDREPEVRRIIAQRLTGADVVPLLSDEDWTVRLEAVKNAPLEELCRLDEEDEEV
LIAISERLETSDT
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaataagccaactgacggaaatttcgacggccctgacgatagaacgcctatcgccgat
tgtcggttttgctcgtatcgagcaaacctccttatgagtggtcgttgctccccaggcgac
gtttgcgtaaaagtggatagcggtcgtcagatagatcgtttctttcgattcaatccgcag
tacgcagaagtttatctacgcgatgacttttgggagcggcgggctatcgcggtacgttat
tcaccgatagatgcgttggaccgactgatacaagacccggacgaagctgttcgcagggcc
gtagcctaccgacttccgagagagcagctctttcagctaatggatgatgaagatcgcgag
gtgagaattaccgtcgccgaccgaattccgttagagcaattggaaaaaatggcggacgac
cgtgattatttggtgcgtgcctatgtcgctcagcggttgagtgaaggtcgtctgttcaga
ttcattagagatcctgaccttcaggtcagaaaaattattgctggtcgactgccggaagag
agtctcggtctaatggcttctgatcgtgaaccggaggtccgtcgtattatcgcccaacgt
ttgacgggtgccgatgtcgtacccctgttgagcgacgaggattggacagttcgattggag
gcggtaaaaaatgcgccgcttgaggagctgtgtcgattggacgaggaagatgaagaggtg
ttaatcgctattagcgaacgcctggaaacttctgacacataa

DBGET integrated database retrieval system