KEGG   Teredinibacter turnerae: TERTU_2099Help
Entry
TERTU_2099        CDS       T00952                                 

Definition
(GenBank) dipeptidyl carboxydipeptidase family protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     TERTU_2099
Peptidases [BR:ttu01002]
 Metallo Peptidases
  Family M2
   TERTU_2099
Exosome [BR:ttu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TERTU_2099
CD molecules [BR:ttu04090]
 Proteins
  TERTU_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ACR12366
UniProt: C5BJ95
LinkDB All DBs
Position
2179383..2181161
Genome map
AA seq 592 aa AA seqDB search
MACNQPEKGSDAAKANAEQYNEESAKAFLKEAEAELGDASLFLNHASWLAATYINFDSQE
VEARAGKEFTLKTVQFAKQVKKWDGADLTPDTRRQLDGLRLALSFPAPDDEKLASELAQI
GSKMQGMYGAGQYCMADGNCMSLGDMSKILAESDDPELMKSVWAGWRDVSPPMRGLYERQ
VEIANQGAQDLGYANLADLWRSNYDMQPEAFAADVDAQWDKVKPFYEALHCHVRAKLNEF
YGDDVVPSQGKIPAHLLGNMWAQTWSNVYDKVKPEVSSSYNLTSLIEKKGMTELDMVKTG
EAFFSSIGFEPLPETFWERSMFTKPRDRDVVCHASAWDLDDKDDLRIKMCIQKNAEDFQT
IHHELGHNYYQRAYKEQPFIYRGSANDGFHEALGDTVALSITPSYLVQIGLLDKEPPVDE
DLGQLLELALDKIAFLPFGLLVDKWRWQVFSGELAPADYNKGWWELREKYQGIAAPVARS
EEDFDPGAKYHIPGNTPYTRYFLAFIQQFQFHKALCETAGYEGPLHRCSIYGNEAAGAKL
KAMMEMGSSKPWQEAMAAVTGQETLDASAIIDYFAPVKAWLDEQNKGRSCGW
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtaatcagccagaaaaaggcagtgacgctgcaaaagccaacgccgaacaatac
aatgaggaaagcgctaaagcctttttaaaggaggcggaagcggagctaggagacgcatcg
ctatttttaaatcatgcgtcctggctggctgcgacctatatcaactttgatagccaggaa
gtcgaagcgcgcgcaggcaaagagttcaccctgaaaacggtgcagtttgccaagcaagtc
aaaaagtgggatggcgctgatcttaccccggatactcgtcgccaactcgacggtttgcgg
ctggccttgagttttcctgcgccagacgacgaaaagttggcgagtgagctagcgcaaatt
ggttccaaaatgcaaggtatgtacggcgctggtcaatattgtatggccgatggtaattgc
atgtcacttggtgatatgagcaaaatcctagcggaaagcgatgatcctgaattgatgaaa
tccgtgtgggccgggtggcgcgatgtctctccgcctatgcgtggcctgtacgaaagacag
gttgagattgccaatcagggggcgcaggatcttggttacgcgaacctggcggatctctgg
cgttccaactacgatatgcagcccgaagcgtttgccgctgacgtcgatgcacaatgggac
aaagtgaagcccttctatgaagctttacactgccacgtacgggctaaattgaatgaattc
tatggcgatgacgttgtgccgtcccaaggtaaaatcccagctcatttacttggtaatatg
tgggcacaaacctggtcaaatgtatacgataaagtgaaaccggaagtcagctccagctac
aaccttacctcattgattgagaaaaagggtatgactgaactggatatggtaaaaaccggc
gaggcatttttctcatctattggatttgagccacttccagagactttttgggaacgctca
atgttcaccaagccacgtgatcgtgatgttgtctgtcacgcgagtgcctgggacctggat
gataaagacgatctgcggattaaaatgtgtattcagaaaaacgcagaagattttcaaacc
attcatcacgaactgggccacaattattatcagcgtgcgtataaagagcagccctttatc
taccgtggcagcgctaacgacggcttccatgaagcgctcggcgatacggtagctctgtct
attacgcccagctatctggtgcagattggcctgctggataaagagccgcctgtagacgag
gatcttggccagctgctcgagttggctctcgataaaattgcatttcttccgtttgggttg
ctcgtagacaagtggcgctggcaggtgttcagcggcgaacttgcaccagcggattacaat
aaaggctggtgggaattgcgtgagaagtatcaaggcatcgccgctccggtagcgcgttcg
gaagaagatttcgacccgggtgcgaagtaccatatccccggcaatacaccttacacgcgg
tatttccttgcatttattcagcaatttcagtttcacaaagcgttgtgtgaaaccgcaggt
tatgaagggccgctacaccggtgttctatctatggtaatgaggctgcgggcgctaagttg
aaagccatgatggaaatgggaagcagtaaaccctggcaagaagctatggccgcagtgact
gggcaagagacgctagatgcatctgcgattatcgactattttgcaccggtaaaagcctgg
ctcgatgagcaaaataaagggcgaagctgcggttggtaa

DBGET integrated database retrieval system