KEGG   Teredinibacter turnerae: TERTU_3021Help
Entry
TERTU_3021        CDS       T00952                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TERTU_3021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACR12398
UniProt: C5BP07
LinkDB All DBs
Position
complement(3375287..3375868)
Genome map
AA seq 193 aa AA seqDB search
MAFELPELPYERGALAPHISEETLDFHYGKHHKTYVDKLNGLVPGTEFEGKTLEEVVKTS
SGGVFNNAAQIWNHSFYWNCLSPNGGGEPTGAIADAINSAFGSFADFKEKFTTSAINNFG
SSWTWLVKKADGSVEIVNTSNAATPLTDDTLTPLLTVDLWEHAYYIDYRNARPSYMDAFW
NLVNWDFVNANFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattaccagaacttccctacgagcgcggtgcgcttgctccgcatatttcc
gaagaaaccctcgattttcactacggtaagcatcacaaaacctacgttgataaattaaac
ggtctggttcctggcacagaattcgaaggtaagacactcgaagaagttgtaaaaacgtca
agcggtggtgtgttcaacaatgctgcgcagatctggaaccactcgttctactggaactgc
ttgagccccaacggtggcggtgagccgactggagccattgccgacgcaattaattccgcg
tttggctcatttgcagactttaaagagaagttcaccacttctgcgatcaacaactttggt
tcaagctggacttggttggtcaagaaagcggatggcagcgtagaaattgttaacacctca
aatgccgcgacgccactgactgacgatactctgacgcctctgttgactgtggatttgtgg
gagcatgcgtactacatcgactaccgcaatgcgcgcccctcgtatatggacgcattctgg
aacctggtgaactgggattttgtgaacgcaaatttcgcataa

DBGET integrated database retrieval system