KEGG   Teredinibacter turnerae: TERTU_3580Help
Entry
TERTU_3580        CDS       T00952                                 

Gene name
aroK_1
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01130  Biosynthesis of antibiotics
ttu01230  Biosynthesis of amino acids
Module
ttu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TERTU_3580 (aroK_1)
Enzymes [BR:ttu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     TERTU_3580 (aroK_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin AAA_18 Cytidylate_kin2 AAA_33 His_biosynth dNK AAA_16 AAA_22 AAA_5 ABC_tran AAA RNA_helicase AAA_24 TsaE RuvB_N APS_kinase Trp_syntA AAA_7 Guanylate_kin Sigma54_activ_2 AAA_PrkA CoaE MMR_HSR1 Ploopntkinase3 ATPase_2 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACR11823
UniProt: C5BRJ8
LinkDB All DBs
Position
complement(3967358..3967867)
Genome map
AA seq 169 aa AA seqDB search
MTRPVFLVGPMGAGKSTIGRMLAQRLEAEFHDTDQVIEARTGADIPWIFDVEGEAGFRDR
ETSVLDDLAQYQDVVIATGGGIVTREQNRHILQAAGTVIYLTASIDQLVNRTYKDKKRPL
LQVDNPREKIVELYTVRDPLYRSVADYVLVTDGRSPKYVVQHIAEYLQR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtcctgtgtttcttgtcggcccgatgggggccggcaaatccaccattggtcgc
atgttggcccagcgcctcgaggctgaatttcacgatacggatcaggtgattgaagcgcgc
accggtgccgatattccctggatatttgacgtggaaggtgaggcgggctttcgtgatcgt
gaaaccagtgtgctggacgatttagcccagtatcaggatgtggtgattgcgactgggggt
ggcattgttactcgggagcaaaaccggcatattctacaggctgcgggtaccgtcatttat
ctcactgctagcatcgatcaactggtaaaccgcacttataaagataaaaagcgccccttg
cttcaggtcgataatcctcgcgaaaagatcgttgaactgtataccgtgcgagacccgctc
taccgaagtgtcgctgattacgtgttggtgaccgacggtcgcagccccaagtatgttgtc
cagcatatcgccgaatacctgcaacgctaa

DBGET integrated database retrieval system