KEGG   Teredinibacter turnerae: TERTU_4695Help
Entry
TERTU_4695        CDS       T00952                                 

Definition
(GenBank) glutathione S-transferase
Organism
ttu  Teredinibacter turnerae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ACR13513
UniProt: C5BKH7
LinkDB All DBs
Position
complement(5154177..5154812)
Genome map
AA seq 211 aa AA seqDB search
MYRIRGFNFAANTAKTAYVAQALGVDYDYVEMIAAKGELKTPEHFKRHPLGKVPTLEHDD
KAIFESNTICKYMAQVEGSELLPTSAYEGALVDQWLNFFTNHLGRWFTVCFFEKHIRALV
GGGDPNEANLEEANGFILQMLPAIEKHLQAQPYFAGQNLSVADYVAFAYFEAGEQSDISF
ADYPAVESWYRGMQSREEIALAKKKMGITGA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtaccggattcgaggatttaatttcgcagccaacaccgccaaaactgcttatgtggca
caagcgttgggcgtggattatgactatgtagaaatgatcgcagccaaaggcgaactgaaa
acgcccgagcatttcaaacgccacccgctgggtaaggtaccgacgctcgagcacgacgat
aaagcgatttttgaatccaacactatctgcaaatatatggcgcaggtggagggcagcgaa
ttgctacccacctcggcttatgaaggtgcgctggtggatcagtggttaaattttttcacc
aaccatctgggccgctggttcactgtgtgttttttcgaaaagcacattcgtgcactggtg
ggcggcggcgatccgaacgaagccaacctggaagaagcaaatggctttattctgcaaatg
ctgcccgccatcgagaaacatttgcaggcgcagccctattttgccggacaaaacctgagt
gttgcggactatgtggcgtttgcgtattttgaggcgggcgaacagagtgatatcagtttt
gccgactacccggcagtggagagttggtaccgcggaatgcaatcacgagaagagattgcg
ctagcgaagaaaaaaatgggtattaccggagcttaa

DBGET integrated database retrieval system