KEGG   Tumebacillus avium: CBW65_00670Help
Entry
CBW65_00670       CDS       T04874                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tum  Tumebacillus avium
Pathway
tum00020  Citrate cycle (TCA cycle)
tum00480  Glutathione metabolism
tum01100  Metabolic pathways
tum01110  Biosynthesis of secondary metabolites
tum01120  Microbial metabolism in diverse environments
tum01130  Biosynthesis of antibiotics
tum01200  Carbon metabolism
tum01210  2-Oxocarboxylic acid metabolism
tum01230  Biosynthesis of amino acids
Module
tum_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tum_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBW65_00670
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBW65_00670
Enzymes [BR:tum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CBW65_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ARU59720
UniProt: A0A1Y0IHG7
LinkDB All DBs
Position
complement(116037..117326)
Genome map
AA seq 429 aa AA seqDB search
MFEKYTAPTKGQKITIENGKLNVPNNPIIPFIEGDGTGPDIWNASVRVFEAAVEKAYKGE
KKLEWFEVLAGEKAFNQTGEWLPNDTLTAFREFLVGIKGPLTTPVGGGIRSLNVALRQEL
DLFACVRPVRYFNGVPSPVKHPEQVDMVIFRENSEDIYAGIEYAEGTEEVKKVIKFLREE
MGAKKIRFPETSGIGIKPVSQEGTERLVRAALDYTIAQNRKSLTLVHKGNIMKFTEGAFK
NWGYEVAEREYADKVFTWAQYDRIKDAEGTEAANKAQSAAEAAGKIIVKDVIADAFLQQI
LTRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANINYVTGHAVFEATHGTAPKYAG
LDKVNPGSVILSGVMMLEFLGWQEAADMIVAALEKAIDQKTVTYDFARLMEGANEVKCSE
FADALIKNL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaagtacacggctccgacaaaaggtcaaaagatcaccatcgaaaatggcaag
ttgaacgtcccgaacaacccgatcattccgtttatcgaaggggacggcaccggtccggac
atctggaacgcttccgttcgcgttttcgaagctgctgttgagaaagcgtacaaaggcgag
aagaaacttgagtggtttgaagttctcgcaggcgaaaaggcattcaaccaaacgggcgaa
tggctgccgaatgacaccttgaccgcattccgcgaattcctcgtcggcatcaaaggcccg
ctgaccactccggttggcggcggcatccgttccctgaacgttgcgctgcgccaagagctc
gacctgttcgcatgcgtgcgtccggttcgctacttcaacggcgttccgtccccggtcaaa
catccggagcaagtcgacatggtgatcttccgtgaaaactccgaagacatctatgccggc
atcgagtacgcagaaggcaccgaagaagtgaaaaaagtgatcaagttcctgcgcgaagag
atgggcgcgaagaaaatccgcttcccggaaacttccggcatcggcatcaagccggtatct
caagaaggcaccgagcgcctcgtgcgcgcagcgcttgactacaccatcgcgcaaaaccgc
aagtccctgaccctcgtgcacaaaggcaacatcatgaagtttaccgaaggcgcgttcaag
aactggggttatgaagtggccgagcgtgaatacgctgataaggtattcacctgggcgcag
tacgaccgcatcaaggacgcagaaggcaccgaagctgcgaacaaggcgcagtccgctgca
gaagctgcaggcaagatcatcgtaaaagacgtgatcgcagacgcattcctgcaacagatc
ctcacccgtccggctgagtatgatgtgatcgcgaccctcaacctgaacggcgactacatc
tccgacgcactggctgcccaagttggcggtatcggtatcgctccgggtgctaacattaac
tacgtcaccggccatgcggtattcgaagcaacccacggcaccgcgccgaagtatgctggc
ctcgacaaggtaaacccgggctccgtcatcctctccggcgtcatgatgctcgaattcctc
ggctggcaggaagcggctgacatgatcgttgccgcactggaaaaggcgatcgaccagaag
acggtcacttatgactttgcacgcctgatggaaggcgcaaacgaagtcaagtgctccgaa
tttgcggatgcgctgatcaaaaacctgtaa

DBGET integrated database retrieval system