KEGG   Tumebacillus avium: CBW65_01185Help
Entry
CBW65_01185       CDS       T04874                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
tum  Tumebacillus avium
Pathway
tum00061  Fatty acid biosynthesis
tum00780  Biotin metabolism
tum01100  Metabolic pathways
tum01130  Biosynthesis of antibiotics
tum01212  Fatty acid metabolism
Module
tum_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CBW65_01185
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CBW65_01185
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CBW65_01185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tum01004]
    CBW65_01185
Enzymes [BR:tum01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CBW65_01185
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CBW65_01185
Lipid biosynthesis proteins [BR:tum01004]
 Fatty acid synthase
  Component type
   CBW65_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: ARU59817
UniProt: A0A1Y0IH67
LinkDB All DBs
Position
220227..220997
Genome map
AA seq 256 aa AA seqDB search
MNQLLAGKKFLIMGVANDRSIAWAIAKQLHEAGATLAFSYQGERLESRVQKLVESTMPGS
PLISVDVTRDEEITAAFGQLKEQWGTMDGVVHSLAYAKAEDLEGTFVDTSREGFHLAHDI
SAYSLVTIARQAKEMMTEGGSIITMTYIGGERIVGNYNVMGVAKAALEHSVRYLANDLGP
AGIRVNAISAGPINTLAARGVKNFTSILPQVAEKSPLRRNITQEEVGKTALFLASDLASG
ITGETIHVDAGYHIMA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaactgttagccggtaagaagttcttgatcatgggcgttgccaatgaccgctcc
atcgcatgggcgatcgcaaaacagctgcacgaagcgggcgcaactctggccttcagctac
caaggggagcgtttggagtcccgtgtgcagaagcttgtggaatcgacgatgccgggttcg
ccgttgatttcggtcgacgtcacccgcgacgaagagatcaccgctgcgtttgggcagctc
aaggaacaatggggcacgatggatggggtcgttcactccttggcatacgcaaaagcggaa
gacttggaaggcacgtttgtcgacacgtcccgcgaaggtttccatcttgcgcatgacatc
tccgcatattcgctggtgaccatcgcgcgccaggcgaaagagatgatgacagaaggcggc
tcgatcatcacgatgacctacatcggcggcgagcgcatcgtcggcaactacaacgtcatg
ggcgtggcgaaagcagcgctggagcacagcgtgcgctacctggcgaacgacctcggtccg
gcaggcatccgcgtcaacgcgatctcggcaggcccgatcaacaccttggctgcgcgcggc
gtgaagaatttcacgtcgatcctcccgcaagtggcggaaaagtccccgctgcgccgcaac
atcacccaggaagaagtcggcaaaacggccctcttcctcgcctccgatctggccagcggc
atcaccggcgaaacgatccacgtcgacgccggctaccacatcatggcgtaa

DBGET integrated database retrieval system