KEGG   Tumebacillus avium: CBW65_09855Help
Entry
CBW65_09855       CDS       T04874                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tum  Tumebacillus avium
Pathway
tum00473  D-Alanine metabolism
tum01100  Metabolic pathways
tum01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBW65_09855
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CBW65_09855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tum01011]
    CBW65_09855
Enzymes [BR:tum01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CBW65_09855
Peptidoglycan biosynthesis and degradation proteins [BR:tum01011]
 Precursor biosynthesis
  Racemase
   CBW65_09855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Rib
Motif
Other DBs
NCBI-ProteinID: ARU63853
UniProt: A0A1Y0IWY1
LinkDB All DBs
Position
2065044..2066189
Genome map
AA seq 381 aa AA seqDB search
MRPTWAEIDLDSIAHNVREVSSILPPGTGLMAVVKANGYGHGALQVAETALQNGASFLGV
AAADEGIELREAGITAPILILGYTPTDCADLVVSHGLAQTVYSPELLHALHDAAMRQNRT
AAIHIKVDTGMGRLGFIDIDEAVEFAKEASTLPALHVEGIYTHFATSDELHSPYAEEQMR
RWGALRERLQNAGLKIPYQHISNSAGILQYTGCPGNMVRLGISMYGYYPSDEVPQDIELR
PALRFVSHIVHLKSVPAGTKISYGATYETTAPAMIATIPVGYADGYSRLLSSKGEALVRG
VRVPVIGRVCMDQLMLDVTAVPGVANGDEVVLYGQQGADRIALEEVAEKIGTITYEVCCM
LGRRVPRKYQHLGKTIQIQTM
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcccgacgtgggcagagatcgacctcgacagcatcgcgcacaacgtgcgtgaagtc
agcagcatcctgccgccgggcaccggcctgatggcggtggtcaaagcaaacggctacgga
catggcgcgttgcaagtggcggagaccgcgctgcaaaacggcgccagcttcctcggcgtc
gccgcagcggacgaaggcatcgaactgcgcgaggcgggcatcaccgccccgatcctcatc
ctcgggtacacgccgaccgactgcgccgacctggtcgtcagccatggcctggcccagacc
gtctacagcccggagctgcttcatgctttgcacgacgcggcgatgcgtcagaaccgcacg
gcagcgatccatatcaaagtcgacaccggcatgggccgcctcggctttattgacatcgac
gaagcggtcgaatttgcgaaagaagcttccacgttgcctgccctgcatgtcgaaggcatc
tatacccattttgcgacatcggacgagctccattcgccgtatgcggaagaacagatgcgc
cgctggggagcgttgcgggagcgcttacaaaatgcgggtctgaaaatcccgtatcagcat
atatccaatagtgcgggcattctccagtacacgggatgccccggcaacatggtccggctc
ggcatctccatgtacggctattacccgtcagacgaagttccgcaagacatcgaactgcgg
ccggcgctgcggtttgtttcacacatcgtgcacttgaagtcagtgcctgcaggcaccaag
atctcctacggcgcgacttatgaaacgaccgcgcctgcgatgattgcgaccatcccggtc
ggctacgcggacggctattcgcgcctcttgtccagcaaaggcgaagcgctggtgcgcggc
gtgcgcgttccggtgatcggccgcgtctgcatggatcagctgatgctcgatgtgaccgct
gtgcccggcgtggcaaacggcgatgaagtggtgctctacggccagcagggcgcagaccgc
atcgcgctggaagaagtggcggaaaagatcggcacgatcacgtatgaagtttgctgtatg
ctggggcgcagagtcccaaggaaataccagcacctgggcaagacaatacagattcaaacg
atgtaa

DBGET integrated database retrieval system