KEGG   Tumebacillus avium: CBW65_10095Help
Entry
CBW65_10095       CDS       T04874                                 

Definition
(GenBank) hypothetical protein
  KO
K13533  two-component system, sporulation sensor kinase E [EC:2.7.13.3]
Organism
tum  Tumebacillus avium
Pathway
tum02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tum00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CBW65_10095
Enzymes [BR:tum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CBW65_10095
Protein kinases [BR:tum01001]
 Histidine kinases
  Spo family [OT]
   CBW65_10095
Two-component system [BR:tum02022]
 Spo family
  KinABCDE-Spo0FA [MD:M00485]
   CBW65_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c PAS_4 PAS_8 HisKA PAS PAS_9 PAS_3 PAS_10 HATPase_c_3 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ARU61307
UniProt: A0A1Y0ILB9
LinkDB All DBs
Position
complement(2109001..2111190)
Genome map
AA seq 729 aa AA seqDB search
MNRKALYTWKYLLPALLILLTTWFLVQVAIDAVHEENRNKLGLVAQILENDIRNNAAAKA
AFLARDNAKLEELLQPMLDQKILEEQGNLGASIYLPDQERNVAFSPRSAMNGSSLDKKVT
ISAEAVRAYQSGQPGYYSVQNEIRKQPIYNYINVLEVDGKKVALISVNQTAASVHGETRT
IWLYGLIICGLALLVLFVAAVGEYRRESTLMRELDNVTKWLKGLTWSSVSTADVDRKLTL
LKKLPAEFQKAIRFVEFARLQKRHVLEHLPLGILMLDVNAKITYANPSLRRLLGRTQEEL
ETMSVEDWRSCYQLADGSYISDLVEKQVQIDNCLGVIRHSNGQEIPFAATLRSLPEDEGK
PLGYFLYVRNLSEEIALDRQEQKIHYLFNAIPMSVLLINEDKEIEYINPSVSRLFSCNEH
DLLGKKLSEALPWELDDHSQVLCEPLHKALSTGMRMHSSNIQALIHGREYDLDFDFFPIL
NAYTSSADGCMILIKDKTLYREWEDLSQRVDQHTNYVQMAATIAHEVRNPMTSVRGFLQL
LSSQITGDTHRKYLDVMTTEIDRMNTILSEYLSMARTPQPEWEPIHLTELVRDTFMLLEG
EANYRGVNLSLELAEDCHIRGIARELKQVLINLVRNAFDALEGGEGLIHLRLQNEQGHYL
LTVTDNGVGIAPEQLTRIFEPFFTTKAMGTGLGLPVCKKIIESHGGSLYVQSELGAGTTF
TIKVPQFFQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaaaagcgctttacacctggaaatacctgctgcccgctttgttgatcctgctg
actacctggtttctcgtccaggtcgccatagatgctgtccatgaagagaaccgcaacaag
cttggactggtcgcgcaaattctcgaaaacgatattcgcaacaacgcagcggcgaaagcg
gcgtttctggcccgtgacaacgccaagctggaagagttgctgcagccgatgctcgatcaa
aagatcctcgaagagcaaggcaacctcggcgcctcgatctatctgcccgatcaggagcgc
aatgtcgctttctccccgcgttcggcgatgaatggcagcagcctcgacaaaaaagtcacg
atctccgcagaggccgtccgggcctatcagtccggccagcccggctattattcggtccaa
aacgagattcgcaaacagccgatctataactatatcaacgtcttggaagtggacggcaaa
aaagtcgccctgatctccgtcaaccagacggccgcttccgtccacggcgaaacccgcacc
atctggctgtacggcttgatcatctgcgggctggcactgctcgtgctgtttgttgcggcg
gtcggcgaataccgccgcgaatccaccttgatgcgcgaactcgacaatgtgacgaagtgg
ctgaaagggctgacctggagctccgtctcgaccgccgatgtcgaccgcaaactgactctg
ctcaagaagcttcccgccgagttccagaaagcgatccgcttcgtcgagttcgcccggctc
cagaaacggcatgtgctcgaacatctgccgctcggaatcctgatgctcgatgtgaatgcg
aagatcacctatgccaatccatcgctgcgccgtctgctcggacgcacccaggaagagctg
gagacgatgtcggtcgaggactggcgcagctgttaccaactggcggacggctcctacatc
tccgaccttgtcgagaagcaagtgcagatcgacaactgccttggcgtcatccggcacagc
aacggccaggagattccgtttgccgcgacgctgcgcagtttgccggaagacgaaggcaaa
ccgttaggctatttcctgtatgtgcgcaacttgtcggaagagatcgcgctcgaccggcag
gagcagaagattcactatttgtttaacgcgatcccgatgagcgtgctcttgatcaacgag
gacaaggagatcgaatacatcaacccgtccgtctcccgcctcttctcctgcaacgagcac
gatctgctcgggaaaaagctgtcggaggcgctgccctgggagttggatgaccacagtcaa
gtcttgtgcgaaccgctgcacaaagcgctgtccacaggcatgcgcatgcacagttccaac
attcaggcgctgatccacgggcgcgagtacgatctggattttgatttcttcccgatcctc
aacgcatacacgtcatcggccgacggctgtatgatcctgatcaaagacaagacgttgtac
cgcgagtgggaggacctgtcgcagcgcgtcgaccagcacaccaactacgtgcagatggcg
gcgacgatcgcccatgaggtgcgcaacccgatgacctcggtgcgcgggttcctgcagctg
ctctcctcgcagatcaccggcgatacgcaccgcaagtatctcgacgtgatgacgaccgag
atcgaccggatgaacacgatcctcagcgaatacctgagcatggcgcgcacgccgcagccg
gagtgggagccgatccacctgacggagctggtgcgcgacaccttcatgctcttggaaggc
gaagcgaactatcgcggcgtcaacctgtcgctggaactcgccgaagactgccacatccgc
ggcatcgcccgcgagctgaagcaagtgctgatcaacctcgtgcgcaacgcctttgacgcc
ttggaaggcggcgaagggctgatccacctgcgcctgcaaaacgaacagggccactacctg
ctcaccgtcaccgacaacggcgtcgggatcgcgccggagcaattgacccgcatcttcgag
ccgttcttcaccaccaaagcgatgggcaccggccttggtctgcccgtctgcaaaaaaatc
atcgagtcgcatggcggctccctctacgtccagagcgaactgggcgccggcacgacgttt
acgatcaaagtgccgcaattctttcaatag

DBGET integrated database retrieval system