KEGG   Tumebacillus avium: CBW65_10305Help
Entry
CBW65_10305       CDS       T04874                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tum  Tumebacillus avium
Pathway
tum03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tum00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CBW65_10305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tum03400]
    CBW65_10305
Enzymes [BR:tum01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CBW65_10305
DNA repair and recombination proteins [BR:tum03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CBW65_10305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ARU63859
UniProt: A0A1Y0IVA2
LinkDB All DBs
Position
2147875..2148930
Genome map
AA seq 351 aa AA seqDB search
MPDAPPVIKTVFPDSFIGQTPCSFSTILPLWYVPSIFRECNRKIPGGLLMLFTAIQPMLL
TLKWDAFDDDRYIFEPKWDGWRVLLHKQGERVSAYTKNGHVITDKFPEAISAASAVSLHE
AILDCEGICMRGGRPVFDDFAWRGRLADPNKIRQATQTHPATFVAFDLLYNGQDLTGSEL
MERKARLHDALRPSDLLTPTLYIEGQGTALKKLSEQQHLEGIVGKRKTSRYQQGVRSEDW
IKVKNWQEIDCIILGYRIAPPFALVLGLHFRTVKFKPVGTVELGFKPEEKQAFHEIAERL
HTTRDSKTQWIEPRLCCHIQYLERTDTHHLRHATFRGFLFEKNPDDCWWTY
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgcgcctccggtgatcaagaccgtatttccggacagcttcattggacagacc
ccctgctccttttccacgattctgccactttggtatgtcccatccatttttcgggaatgc
aatagaaaaatccccggaggtctcctcatgctgtttacggcgatccaaccgatgcttttg
acgttgaaatgggacgcgtttgatgatgaccgctacatctttgagccgaaatgggacggc
tggcgcgttctcttgcacaagcagggggaacgggtctccgcatacacgaaaaacgggcat
gtcatcaccgacaaattcccggaggcgatctcagcagcctccgccgtctcgctgcacgaa
gcgatcctcgactgtgaaggcatctgcatgcgcggcgggcgtcccgtctttgacgacttc
gcctggcggggacgcctcgccgacccgaacaagatccggcaggccacacagacgcacccg
gccacctttgttgcattcgatctgctctacaacgggcaagacctgaccggctccgagctc
atggagcgcaaagcccggctccacgacgccctccgcccctccgatctgctcactcccacc
ttgtacatcgaagggcaaggcacagcgttaaaaaagctcagcgagcagcagcacctcgaa
ggcatcgtcggcaagcgcaaaacgtcgcgctaccagcaaggcgtgcgctccgaagactgg
atcaaagtaaaaaactggcaggagatcgactgcatcatcctcggctaccgcatcgcgcca
ccgtttgcgctggtgctcggactgcattttcgcaccgtcaaattcaagccggtcggaacc
gtcgaacttggcttcaagccggaagaaaaacaagcgttccacgagatcgcggaacgcctg
cacaccacccgggacagcaaaacgcaatggatcgaacctcgcctctgctgccacatccaa
tacctcgaacgcaccgacacgcaccacttgcgccatgccacatttcgcggcttcctgttc
gagaaaaatccggacgactgctggtggacgtattag

DBGET integrated database retrieval system