KEGG   Tumebacillus avium: CBW65_17945Help
Entry
CBW65_17945       CDS       T04874                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tum  Tumebacillus avium
Pathway
tum00440  Phosphonate and phosphinate metabolism
tum01100  Metabolic pathways
tum01120  Microbial metabolism in diverse environments
tum01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CBW65_17945
Enzymes [BR:tum01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CBW65_17945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL REPA_OB_2
Motif
Other DBs
NCBI-ProteinID: ARU62644
UniProt: A0A1Y0ITF6
LinkDB All DBs
Position
complement(3676238..3677119)
Genome map
AA seq 293 aa AA seqDB search
MNARQQLRKMMQEPGRVIQTVGAHNALGAKLVEQNGFDAVWASGFEISTAHAKPDANILT
MVEFLNAASQMADATTLPVIADCDTGFGNVNNVIRMVRDYEKAGIAAVCIEDKVFPKMNS
FIPGYQSLAPKDEFAAKIRAAKDTQQDPDFVVIARVEALIAGHGMEEALERAAAYDDAGA
DLVLIHSKQKDPGEIFEFSRRWTSETPLVIVPTTYPSITLADMSEHNIKMTIYANQALRA
AVKAMNAVLAQLKESGSLLAIQDQLSPMDQLFELQGLKDMIKQEEHYKKLEVR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaagacaacagttgcgcaagatgatgcaggagccggggcgtgtgatccaaacg
gtgggggcgcacaacgcactgggagccaaactggtggaacagaatggttttgatgccgta
tgggcaagcggatttgaaatctcgaccgcccacgccaagccggatgccaacatcttaacg
atggtcgaatttttaaacgcagcatctcagatggccgatgccacaacgctgccggtcatc
gccgactgcgatacgggatttggcaatgtaaacaatgtgattcgcatggtgcgcgattac
gagaaagccgggatcgctgccgtctgtatagaagataaggtgtttcctaaaatgaactcc
ttcatcccgggctaccagtcgctggccccaaaagatgaatttgcagccaagatccgcgcc
gccaaagacacgcagcaagaccctgattttgtggtcatcgcccgcgtcgaagcgctgatc
gccggccacggcatggaagaagcgctggagcgggcagccgcgtatgacgatgcgggcgcc
gacctggttttgatccactccaagcaaaaagaccccggcgagatctttgagttcagccgc
cgctggacgtccgaaactcccttggtcatcgtgccgaccacctacccgagcatcacgctg
gccgacatgtccgaacacaacatcaagatgacgatctatgccaaccaggccctgcgtgca
gctgtcaaagcgatgaacgcggtgctggcccagctcaaagaatccgggtcgcttctggcg
attcaagatcagttgagcccgatggaccagctgtttgagctgcaaggcttgaaagacatg
atcaagcaggaagagcattacaaaaagctggaagtccgttaa

DBGET integrated database retrieval system