KEGG   Tumebacillus avium: CBW65_18650Help
Entry
CBW65_18650       CDS       T04874                                 

Definition
(GenBank) hypothetical protein
Organism
tum  Tumebacillus avium
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Thioesterase Abhydrolase_6 Hydrolase_4 Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: ARU62762
UniProt: A0A1Y0IQ71
LinkDB All DBs
Position
3876736..3901464
Genome map
AA seq 8242 aa AA seqDB search
MCFRRGNMTTLISKFSTLIELLQWRAGHQGDQAAYTFLLEDGEERLFTYADLDRKARDIA
AGLQKHHQAGERALLLYPPSLDYIAAFFGCLYAGIIAVPAYPPRANGHLGRLQAIVADAE
ATIALTTPGILAGIETRFADSPQLRDLAWMVPGETEEEAAAVWYDPEADKSSLAFLQYTS
GSTSLPKGVMLSHGNLLHNLELIESCFGTTADGHGVIWLPPYHDMGLIGGILQPLFTGYS
VTLMAPVDFIQKPFKWLETISRLGAAVSGGPNFAYELCLQKITPEQRDTLDLSSWEIAFT
GAEPVRAETLERFAEFFAPCGFKKEAFYPCYGLAEGTLFVSGGVKREAPVVRQFDGDALS
VNRVEEVCEGQEGDRLLVSSGRLAIVGQQIVIADPVTGERCADDEVGEIWVSGPSVAQGY
WNREEQTEETFRASLAGTGEGPFLRTGDLGFVQDGELYVTGRLKDLIIIRGRNFYPQDIE
FAVQESHPAVKNSNGAAFSVEVDGEERLVVVQEIERVYRKANLAEVAATVRATVSEEHQL
QVHAVVLIKPVSIHKTSSGKVQRHACKAGFLAGTLEVLYSDALDGVSDANGAFAGAEGDA
LPTSDTQEPAFTRETVLALAPEQRHAALVEYLHRLSAQVLRVSPALVQADKSLNALGLDS
IMAVELKHEVEENFGIVLPFTLLLAGPSLTELAVEIASQVTLLQESVPTAEAVPSQAEQS
DHIPLSKGQRALWFMQRLAPDSAAYNISRAAVIRDLDVQKLHGAFNQLVMRHPLLRAQIT
VQHGEPVQVIREQAKAYFVVENAVEWSEVALQERLQAEANRPFDLEQDELLRVGLFTRSE
QEHVLILTIHHIVADFWSLGVLVQELEALYNGNAPVQPLRSYAEFVEEQNRFLDGLRGTE
LATYWDEKLGGELPILDLPTDRPRPPVQTYRGAVAPFQLSTDLTAALKKLAGEQSATLYT
VLLAAFQVLLYRYTGQEDLLVGSPTTGRSSAKDAATIGYFVNPVVLRADLSGKPAFADFL
TQVRQTVLEALDHASYPFPLLVERLQPDRDQSYPPMFQTVFALQKSHLAQSDALGGFALG
QSGATFELGDLRLESADLLQQGAQVDLTLFMAEQQGALSGAFEYNPDLFDPSRIERMTAH
FATLLQGIAENAGQSIAELPLLSKAEQAQLFTWNDTATEYGQGQSIQQVFAAQVKRTPDA
VAVVFGEQSLTYRELDKRANSLARRLQKLGVEHGQLVGFYLERSLELPIAMLAILKAGAA
YVPFDARYPADRLSYMFADTQVRVLLTQADMAEQLPSHGAQVVCVDTDASIWEECGETLS
RDVADGESLAYVMYTSGSTGLPKGVLVPHRGVVRLVKNANYLDIRPDDVVMQYMAVAFDG
STCEIWGALLNGAKLVVAPPGHTSLEEIGAVVEQYKATVLMLTTGLFIQMVDYQFGGLRG
VRVAITGGDVLSVPHAKKVLDLLDITLINGYGPTENTTFTTCYVMTDSSQVGYSVPIGQP
VSNTTVYLLDANGQQVPVGVPGELLTGGDGLTHGYLNKPEQTAEKFVDNPFGDGKLYRTG
DLARWREDGTVEFMGRVDNQVKIRGFRIELGEVEAALNTHPHVLQAYVMVHSMAAGDKRL
AAYVTAEGDVTPAELRQYMKGLLPEYMVPSAFAVLEELKLTPNGKVDRRALPEPDFSLSE
GEYLAPRTPREEVVAGIWASVLSAEQVGVEANFFELGGHSLLATQVMSRVNEAFGLKLPL
QSLFESPTVAGLAEQIQRAEESKGTVAARTPIVAVERGEALPLSFAQQRLWVLEQFMGGA
AVYNMPYALCLQGELHVAALERTLNEIIARHESLRTTFVKAAEQPVQVIHEAVWTPLTVQ
EMAEAELLDVVQADAKTPFDLSAGPLVRFRLVKLETEEHVLVFNMHHIVSDGWSAAVFVR
EFAALYSAFSQGVASPLAPLAVQYADYAVWQRDWLQGDVLDGQLAYWKQQLGGELPTLQL
PTDRPRPAVQTYNGAVEKFVLSAELTSALQGVSNRKGATLFMTMLAGFQVLLSRYSGQEE
VCVGTPIAGRTQRETEDMIGFFVNTLVMRTDLSGAPSFDELISRVRDVTLGAYAHQDVPF
EKLVEELQPERDMSRSPLFQVMFDVLNDGITDMELPGLKLSSLDVDSGTAKFDINLTFMK
EGGQLVGSFEYNTDLFERATVSRMIGHFSRLLEVAAAQPELSIAELPLLSAEERTELLLA
GNDLTAQFPQEICIHERFERQAERTPHAVAVVYEGESLTYRELNERANQLAHYLQKQGVG
PEVLVGLAVERTLEMVVGLLGILKAGGAYVPLDPSYPQDRLAFMLEDSQIAVLVTEEQHL
ATLPAHEAVAVCLDRDALEIAKESAENLASGATPDNLAYIIYTSGSTGKPKGVLIPHANV
GRLFDATEHWYHFDEKDVWTVFHSYAFDFSVWEIWGALFYGGKLVVVPYWVSRSPEAFYE
LLVAEQVTVLNQTPSAFRQLMQAEERAAEKASLALRYVIFGGEALELTSLTAWFERHGDV
TPQLVNMYGITETTVHVTYRPITLADVESGAGSVIGAPIPDLQVYVLDAHHQPVPFGVAG
EMYVGGAGVARGYLNRADLTEERFIRNPFGDGRLYKTGDLARRLANGELEYYGRIDQQVK
IRGFRIELGEIESVLVSHPAVQECVVMAREDVPGDKRLAAYFVGNEQGTLEIGELRSYLK
EQLPEYMIPSAFVEMDVMPLTANGKIDLRALPVPEQSAAAMREYVAPRTEKEKLLAMIWA
DVLRADRVGAEDNFFELGGHSLLATQVISRVNEAFGVQMPLRVLFESPTIAELAENLEGL
AGTASSQRTPIEKVSRDAALPLSFAQQRLWVIDQLMPGSAVYSIPFAVRLQGHLHVEAME
QGLNELISRHESLRTTFVNADGGAVQVIAEPVWTALQVLDVESEADVQALILAEATQPFD
LTAGPLVRFRLLKLGAEEHVLVANMHHIISDGWSIGVFTEEFAALYEAFRNGETSPLQDL
PIQYADYANWQREWLQGDVLDEQLAYWKGKLGGELPVLQLPTDRPRPPVQTHHGAVERFQ
LSEALSEAVQKLSQQYGATLFMTLLGAFQALLSRYTGQEDIAVGTPIAGRHHGETEGLIG
LFVNTLVMRTDLGGNPTFADLLSRVRETALGAYAHQDVPFEKLVEELQPERDMSRTPLFQ
VLFVLQNARLTDIELPELALQMIDADGGMAKFDLELAMEEQEGRIAGALNYNTDLFDADT
ISRMIGHFVTLLEGVVQEPHEALSELPLLTPAEEGQLLDEWNGALLDVPNACLHKLFEAQ
AAKTPERTAVVFGDESLTYAELNARANRLAHHLQQHGVRPDVLVTLCVERSLDLMVGVLG
ILKAGGAYVPLDTSYPEERIKLILEDTQAPVLVTQSHLLANLPLFKNETVCLDTDWAAIS
TKPDTNPVSAAKSYHLAYMIYTSGSTGRPKAVMVEHGNLVSTLQASQERFRFGEDDVMPW
IASVAFDIALFESMNTLLQGGTTVILAREHVLDLPSLIQDLKGYTAIHTVPSLMRQIVQT
MRDGGVPASEYDGMRLVFTGGDAVPPDLLDEMKEVFRNAEIHVLYGPTEGTIICSNYQVP
RGEGMTRLLIGRRLDNANLRVYDANQQLVPIGVPGELYIGGSGVTRGYYQREELNAEKFV
TLAGDRWYRTGDLVRYLADGTLEFLGRIDNQVKIRGFRIEIGEIEAVLTQHPHVHESVVI
VHESERGDKRLAAYLVPEEGESADTAELRSYLKDKLPEYMVPSFLILLDALPLNPNGKID
RKALPAPDAMALEATVYTAPRTETEAVVAGIFAEVLGLEQISIDDNFFSLGGHSLLATQV
ISRLSSALGTQIPLRHLFEAPTVADFAGSLQLGAANLAIEPVSRDGELPMSFAQQRLWVI
DQLMPGHTAYNMPLAVRLQGELDVQAFENALNDILLRHEALRTTFAENAAGLPVQVIAAP
EWQILTHIDLRELSAADREAAAQRLAQEDAETPFDLTAGPVIRFSLLQMAENDHVLLLNM
HHIVSDGWSMGVFVKEFTLLYQAHLRGEEVVLAPLPIQYADYAHWQRETLSGDKLDTELH
YWKNQLSGELPLLQLPTDLAGEETQEGADVSLTLSKELTDSLQALSQRYGATMFMTILGA
FQTLLHRHSGQEDICIGTPIAGRSAVETEGMIGFFLNTLVMRTDLTGAPTFAELLGRVRE
TALGAYAHAELPFEKLVEEVQPERRLNRNPIFDVLVNYLNMPPLQAELPELSVTPLPSVE
QEAKFLLSLIVQEQEGAGLGLRLIYRTSLFSEARITEMLAQFAALLEQIAVNPDVAINAY
SLVTEASRALLPDQTAVFDGPVYPFVQDLFTEWADRTPDQTAVSQGDQAWTYAQLSWRGA
ILAAALQARGVQQGDVVAILSTRCFGLIASMLGVLKSGGVLLMIDEDLPTARKRVMLEES
KAKHVLHITEGQAQGEMAELLAAYDVLTVDLNGEGEGEGELESHAIASAFVQPDLSPDDP
AYIFFTSGTTGVPKGVLGRHNGLSHFLIWQRETFNIGPDDRSSQLIHLSFDVVLRDIFLP
LTSGATLCLPDRMDDLSAEYLLPWLEREEISVLHTVPSLAASWVSQAPAGVTLSALRCLF
TAGEPLTDVLVGRWRDRFPQLGDIINLYGPTETTLAKCYYVVPEQPLPGIQPVGTPQPNT
QVLILNELGALCGIGEAGEIVIRTPYRSLGYINNAEEQAKRFVGDLYFTGDKGRYRPDGL
LEILGRVDDQVKVRGVRIQLNEVSSTLARHAAVDACTVLDWKDEQGEVTLVAYVVLKQSQ
TLTSAELRAFLSGQLLAAMVPSAFVFLEQLPLTSNGKVDRKALPRPEQLSYEEAAYVAPR
TETEAQLAAIWADVLKAEGVGVTANFFDLGGHSLLATQMISRARQAFTVELTLHSLFERP
TVAQLAELIDASRGLQAEGAALVPVVRDGDLPLSYAQQRLWFLDQLESNSAAYNIPLILR
IEGALDLPTVEQTMQELVRRHETLRTTFAEGEGQAVQKIAPAASGAVQATLEQIGASAAE
LSDSTVTVTVPFNVLPEAEALAFLQQEAQRPFDLSHGQLIRANVVKVADNDHFLLINMHH
IISDAWSVGVLLNEFAALYEAFATGHASPLSELAIQYADYAVWQREWLQGDRLTTQLDYW
KQQLGDDVPILQLPTDRPRPPVQTFAGAQIPFALSEELTDGLNSLSRQTGTSLYMTLLAA
FQTLLSRYTGQEDIAVGSPIAGRQRTELEGLIGFFVNTLVLRTDLSGQPTFRDLLQRVRR
TALDAYANQDVPFEMLVGELGVERNLSYSPLFQVMFALQNVPLADREVAGLTLSPVPFEV
QTSKFDLAMTLVEQGETITGALDFNTDLFDRETISRLIANFQTLLGALLADPDCPIGKLA
LVTPEEAQQLHAWNETMADFPAERTIQEQFAEMVRLHPDRIAVSDGEQSLTYRELNDRAN
ALAHELLARGVQPNQLVGFMLERGVQVLVSIFGILKAGAAYMPVDADYPAERITYMLEDS
GAVWLITQQSLQERAKALAPNVLCLEDVAHGTALGDPDAVNTPDDLAYVIYTSGSTGRPK
GTLMRHTGVLNLAQWAHDTLGDTEHDTILQYSNNSFDASVQEIFCALLNGSRLHVLSQDE
RLSIEAFADAVYQTQATAVLLPTVFFHQVGSYLSDQAVQKLASLKRIIVGGEAVSSESVR
NWQRRFGTGMEVINAYGPTEITVICTVYRMQELLPDEVVNLPIGKPMSNFQHYILNQQLE
LCPIGVVGELYIGGVSLAKGYHNQPEKTAEVFLPHPFLDGARVYKTGDLARWLPDGNIEY
MGRIDHQVKIRGFRVELTEIEDRLGKHPSLQHVVVIARDQRLVAYVVPQKSQSVDSGALR
SYLKEKLPEYMIPSAFVVLDALPLTPNNKVDLRALPAPELSHLVETDSYAAPRNEVEAVL
AEVWQTVLRLDKVGIHDNFFELGGDSILSIQIINRAGLQGIRLTPKDLFQSQTIAELAER
AQTGAALTTVDNGPVTGPVLLTPIQQWFFEQNLADPNHWNMSVLFELREQLDVERMRDAV
SQLLTHHDALRMRYEQVAGEWKQTILEPGGEVPFVTVDLSGREDAFEAEADNWQKSLQLT
DGPMLRFVHVDFGGTRNSILLLIVHHLVIDGVSWRILLQDLEAAYSKRQLPPKTTSFQTW
SERLSHYAATPAILQEKEHWLQLQATPVAELPVDHAHGANTIGSGRRISLSLTAEETQQL
LQEVPQAYNTQINDVLLTALVEAFAKWTGERALLLDFEGHGREEIGEDIDVSRTIGWFTT
MYPVLLQLHDTAEAGPRIKSVKEQLRAIPNRGIGYGLLRYLNGEEALQKMHAAQVSFNYL
GQFDQVTEASALFQVSNLPGGAPRDEANPRHHLLEINGAVQGGQLHMSWTYSANVHEQAT
VEKLAQSFMNELLAVIRHCLSAEAGGFTPSDFPEARLSQERLDELVASLAERSVTRTDIE
AIYQLSPMQQGMIFHSMMSPEAGVYVVQMNMELHGTLDESALQRAWQKVLLRHPILRTGF
EWKGLETPQQVVYRHVKLPIETLDWRGEPSADLEAFLLQDRIRGFDLSTAPLMRLTLIRL
GDSMYRLVWTSHHLLFDGWSMPLVFKELVTAFEAEVRGTEAQFSPKRPYRDFIAWLQEQD
MAAAERFWRGKLSGFSAPNRLPVERTSPPATTPAKRYGEQKVTLSASTATALQDAARAHG
LTLNTLFQGAWALLLSRYSREQDIVFGATVSGRPTDLAGADSMIGLFINTLPMRLHTAPE
QSVLSFLKELQAQQVEVRDYEYTPLVQVQGWSDVPRDQPLFESIVVFENYPLDESIVPAF
GDLEVKEMSTLEMDSYPLTVMALPGVEFTIKVAFDHLRFEADVITRLIGHLQTLLLSLLD
QPEARLADVPMLSEAERHQLLVDWNDTEVDYPQDDRIHELFEAQATRTPSAFAVIHGTEQ
LTYAELNARANQLAHRLQRVGVGPDVLVGIAVERSLEMVVGLLGILKAGGAYLPIDPAYP
SERISFMLEDSGVGVLLTQGHLTASLPEHRAEVICLDTDWAAIAEESAEACVSAGTADNL
SYMIYTSGSTGTPKGVLISHRAVVNHNFAISRAYGLGASDRILQFASISFDIAVEELFPT
LLCGATLVLRGEQMAAGDFLRWVEEQGITVLNLPTAYWHSWVHELALQSAVLPAALRLMI
VGGEKASPEAYAVWQKLAGQPVRWINAYGPTEATVTATMYEPSGEEAHDALNLPIGRPID
NLQLYVLDEHLHPVPVGVPGELHIGGAGLARGYLNRPELTADKFIPNPFGAAGTRLYKTG
DLVRYLPDGNLECLGRTDDQVKVRGFRIELGEIETLLEGHPAVQSGVVVVRDERLVAYFV
GDDAADIRAYMKEKMPEYMIPSAFVALDELPMTPNGKVDRRALPAPGTSFTTPGTGTEYE
EPRNKTEQALAEIWQNALRRERVGIRDNFFELGGDSILSLQIISRAAAKGIRLTPKDLFT
HQTIAELAQAAGTVSGEHIADQGEVTGDVLFTPIQHWFFEEEMHNANHWNMSMLFETREK
LDDAILQDVLAHLLQHHDALRMQFADGKQVSAAWSGDVPLTSIDLTHLPLDEQEAAFEAE
ASRLQGSLDLQAGMPVRFAAFTFGAGLPSRLLLIVHHLVIDGVSWRILLEDLELAYTQRL
SGAEIKLPLKTTSYQAWAKQLADYAKSSTLQQERKYWLQQSHSAPLPTDLAAGANTEASA
QHVSVTLDAAHTQALLQEAPKAYNTQINDLLLTALVEAFGTWTGERALLLDLEGHGREEI
LDGVDLSRTVGWFTAVYPVYLNLTDATQPGQKIQTVKNHLRAIPNKGIGYGLLRYLNGDA
ALAELPSAEVQFNYLGQLDQSLAESGVFTVSTADGGASRDPQNPRSHLLEINCAVTGGQL
QVNWTYSGNVHDKATVEKLAGQYLEALQELIRHCQSPDEWLTDEVGIQWNLSSPNCLMPL
NNALTGTPLFLVHPVGGVAQIYTELAYELGDRPVYGLQSRGLDESETPFATVEEMAACYV
DAIRTVQPYGPYQVGGWSMGGLVALEMAQQLQAAGEEVSFLGLLDTPAQHLGGHDGQPTP
VHRLLTTFAEELTGRFGIEMPGAEELAQTLTVDEFLQQFITAAARTKALPPHIGLEQVKR
FFRVLQANDAANCIYEQHFYDGTVTMFRAIEDPQQGSKGLTFGWDTEASTVHVHTVRGSH
HNMVLPPYVKMLGALMRACLEE
NT seq 24729 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttcaggaggggaaacatgacaacactgatcagcaaattttctactttgatcgaa
ctgttgcagtggcgtgccggccaccaaggggatcaggcagcctacacgtttttgctggaa
gacggggaggagcggctgtttacgtatgccgacctcgaccgcaaggcgcgcgacatcgcg
gcgggcttgcagaaacatcatcaggccggggagcgggccttgctcctgtatccgccgagc
cttgactatatcgcagcgttttttggctgcttgtacgcaggtatcatcgcggtgccggct
tatccgccgcgcgcgaacggccatctcgggcgactgcaggcgatcgtcgccgatgcggaa
gcgacgattgcgctgaccacgccgggaattttggcgggcatcgaaacgcgctttgccgat
tcgccgcagctgcgcgatctggcctggatggtgccgggcgagacggaagaggaagcggct
gctgtttggtatgacccggaggcggacaagtcgtctctggcctttttgcaatatacgtcc
ggttccacgtcgctcccgaaaggcgtcatgctcagccacgggaacttgctgcacaacttg
gagctgatcgagagctgctttggcacgacggccgacgggcacggcgtgatctggctgcct
ccttaccatgacatgggtttgatcggcgggatcttgcagccgctgttcactggctactcg
gtaacgctgatggccccggtcgattttattcaaaagccgttcaagtggctggagacgatc
tcgcgcctcggagctgctgtcagcggcgggccgaattttgcctatgagctgtgcctgcag
aaaatcacgccggagcagcgcgacacgctcgacctgagctcgtgggagatcgcgtttacc
ggagcggagccggtcagggcggaaacgctggagcggtttgctgaattttttgcgccgtgc
gggtttaagaaagaggcgttctacccctgctatggcttggccgaagggactctgttcgtc
tccggcggcgtgaagcgggaagcgccggttgtccgtcagtttgacggggatgcgctgagc
gtgaaccgggtggaagaagtgtgcgaagggcaggaaggcgaccgtctgctggtcagttcg
gggcgtctcgcaatcgtcgggcagcagatcgtcatcgccgacccggtgacgggcgagcgg
tgtgccgacgatgaggttggcgaaatctgggtatccggcccaagtgtggcgcaaggctat
tggaatcgcgaagagcagacagaagagacgtttcgcgcctctctcgccggaacgggcgaa
gggccgtttttgcgcaccggtgacctcggcttcgtgcaggacggcgagctgtatgtgacg
gggcgcttaaaggacctgatcatcatccgcggccgcaacttctacccgcaggatattgag
tttgctgtgcaggagagccacccggctgtgaaaaacagcaacggggccgctttttcggtc
gaagtggacggggaagagcgcctggtggtggtgcaggagatcgagcgcgtgtaccgcaaa
gcgaacctcgcagaggttgcggcgacggtcagagcaactgtctcggaagagcaccaactg
caagtgcacgccgtggtgctgatcaagccggtctcgatccacaagacctcttcgggcaaa
gtgcagcgccatgcttgtaaagcaggctttttggcgggcacgctggaggtgctgtacagc
gatgcattggatggtgtgagtgatgcgaacggtgcgtttgcaggtgcagaaggagatgca
ttgccgacctctgatacgcaagagccggccttcacccgcgaaaccgttttggcactcgct
cctgaacaacgccatgcagcgttggtcgaatacctgcatcgcctgtcagcgcaagtgctg
cgcgtgtctcctgctctggttcaggcggacaagtccctgaacgccttgggacttgactcg
atcatggcggtcgagctgaagcatgaagtggaagagaacttcggcatcgtcctgccgttt
acgctgctgctggccgggccgagcctgaccgaattggcagttgagatcgcatcgcaggtg
acccttctgcaggaatcggtgccaactgctgaagctgtgccgagtcaagcagagcagtcc
gatcacatcccgctctccaaaggccagcgcgcgctctggttcatgcagcgtctcgcgccg
gacagcgccgcctacaacatctcccgcgccgctgtcatccgcgacctcgatgtgcaaaag
ctgcacggggcgttcaaccaactcgtcatgcgccatccgctcttgcgcgcacagatcacc
gtgcagcacggcgagccggtgcaagtgatccgcgagcaggccaaggcgtattttgtcgtg
gaaaacgcagttgagtggagcgaagttgccctgcaggaacgcctgcaggcggaagcgaac
cgcccgtttgatctggagcaggatgagctcttacgcgtcgggctctttacccgttcggag
caggagcatgtgctgatcttgacgatccatcacatcgtcgccgatttttggtcgctcggc
gtgctggtgcaggaactggaagcgctctacaacgggaacgcgcctgtgcagcctctgcgc
agctacgcggagttcgtcgaagagcaaaaccgcttcttggacggcctgcgcggcacagaa
ctggcgacttattgggatgaaaaactgggcggggagctcccgatcctcgatttgccgacc
gaccgcccgcgcccgccggtgcagacctatcgcggcgcagttgcaccgttccagctctcg
accgatctgaccgcagcgttgaaaaagctggccggggagcaaagcgccaccttgtacacg
gtgcttttggcggcgtttcaagtgctgctctaccgctataccgggcaggaagacctgctc
gtcggctcgccgaccaccggccgcagttcggcgaaagacgccgcgacgatcggctatttt
gtcaacccggtcgtgctgcgcgccgacctgtcgggcaagccggcgtttgccgatttcctg
acccaggtgcgacagacggtgctcgaagcgcttgatcacgccagctacccgttcccgctg
ctcgttgaacgcttgcagccggatcgcgaccaaagctatccgcccatgttccaaacggtg
ttcgctctgcaaaaatcgcatctggcgcaaagcgacgccttgggcggttttgcattaggc
cagtccggcgcgacgtttgaactgggcgacttgaggctggaatcggcagacctcctgcag
caaggtgcgcaggttgacctgaccctgttcatggccgaacagcaaggtgctttgtctggc
gcgtttgaatacaacccggacctgtttgatccgtcccgcatcgagcggatgacggcgcat
tttgcaacgctgttgcagggtatcgcagagaatgcggggcaaagcattgccgaactgcct
ctgctgagcaaagcggaacaggcgcagctcttcacttggaacgatactgcgacagagtat
ggacaaggccagtcgatccaacaggtgtttgcggcgcaagtgaagcgcacgccggacgct
gtggcggtcgtatttggcgaacagtctttgacctatcgggagctggataaacgggcgaac
tctctcgcacgccgcttgcagaagcttggtgtggagcacggccaattggtcggcttctat
ctggagcgctcgctggaactgccgattgccatgctcgcgatcttgaaggcgggggcagcg
tatgtgccttttgatgcccggtatccggccgaccgtctgtcctacatgtttgcagatacc
caggttcgcgtcctgctcacccaagcggacatggcggagcagttgccctcgcatggggca
caggtcgtctgcgtggacacggacgcttcgatctgggaggagtgcggcgaaaccttgtcg
cgcgatgttgctgacggggaaagcctcgcctatgtgatgtacacctccggttcgaccggc
ctccccaaaggcgttttggtgccgcatcgcggggtcgtccgtctggtcaaaaacgcgaac
tacctcgacattcgcccggatgatgtggtgatgcaatacatggcggtcgcgtttgacggt
tcgacctgcgagatctggggggcgctgctcaacggcgcgaaactggtcgtggccccgccc
ggccatacgtccttggaagagatcggcgcggtggtcgaacagtacaaagcgaccgtgctg
atgctcaccacaggtctgttcatccagatggtcgactaccagtttggcgggctgcgcggc
gtgcgcgtggcgatcaccggcggggacgtgctgtcggtgccgcacgcgaaaaaggtgctc
gatctcctcgacatcacgctgatcaacggctacggcccgaccgaaaacacgacgtttacc
acctgttatgtgatgaccgattccagccaagtcggctacagcgtgccgatcgggcagccg
gtctcgaacacgacggtgtatctgctggacgccaacggccagcaggtgccggtcggtgtg
ccgggcgagctgttgacgggcggtgacgggttgacgcacgggtatttgaacaagccggag
cagacggcggagaaatttgtggacaacccctttggcgacggcaagctgtaccgcacgggc
gacttggcccgctggcgggaagacggcacggtggaatttatgggccgtgtggacaatcag
gtgaagatccgcgggttccgcatcgagcttggcgaagtggaagcggcgctaaacacgcat
ccgcacgtcctgcaggcttatgtgatggtgcatagcatggcggccggggacaagcgtttg
gccgcgtatgtgacggcagaaggggatgtgaccccggctgagctgcgtcagtatatgaaa
gggctgctgccggagtacatggtgccgtccgcatttgccgtgctggaggagctcaagctc
acaccgaacggcaaagtggatcgccgtgcgctgcccgagcccgatttttccctctcggaa
ggagagtatcttgcgccgcgcacccctcgggaagaagtcgtcgccggcatttgggcgagc
gtgctgtcggccgagcaggtcggcgtggaagcgaacttctttgagcttggcgggcattcg
cttttggcgacgcaggtgatgagccgcgtcaacgaggcgtttggcttgaaactgcccctg
caaagcctgttcgagtcgccgacggtggccgggctggccgagcagattcaacgcgcggaa
gagtcaaaaggcactgtggcggccagaacgccgatcgtggcggtcgagcgcggcgaagcg
cttccgctttcctttgcccagcagcgcctgtgggtgctggagcagttcatgggcggcgct
gcggtgtacaacatgccgtacgcgctgtgtctgcaaggggaactgcatgttgcggcgttg
gagcggacgttaaatgagatcatcgcccgtcatgagtcgctgcggacgacgtttgtaaag
gcggcagagcagccggtgcaggtgattcacgaagcggtgtggacgccgctgacggtgcag
gagatggcggaggcggaactgctcgacgtggtgcaggcagacgccaaaacgccgtttgac
ctcagcgctggtccgctggtgcgcttccgtttggtgaaactggaaacagaggagcatgtg
ctggtgtttaacatgcaccacatcgtgtcggacggctggtcggccgctgtgtttgtgcgg
gagtttgccgcgctgtacagcgcgttttcgcagggcgttgcatctcctttggcaccgctt
gctgttcagtatgccgactatgccgtctggcagcgcgactggctgcaaggggacgtgctg
gacgggcagctcgcgtattggaaacagcagctcggcggcgaactgccgactctgcaactg
ccgaccgatcgtccgcgcccggctgtgcagacctacaacggcgcggtggaaaaatttgtc
ctgtccgcagagctgacctcggcgctgcaaggggtgagcaatcgcaaaggcgcgacgctg
ttcatgacaatgctggcagggttccaagtgctcttgtcccgctacagcggacaggaagaa
gtctgtgtcggcaccccgatcgccggacgcacgcagcgcgagacggaagacatgatcggc
tttttcgtcaacacgctggtcatgcgcaccgatctgtcgggcgcgccgagcttcgacgag
ctgatctcccgcgtgcgcgacgtgactttgggcgcgtatgcccatcaggatgttccgttt
gaaaaattggtcgaagagctgcagcccgagcgcgacatgagccgttcccctctgttccag
gtgatgtttgacgtgctgaacgacgggatcaccgacatggagctgccggggctgaagctg
tcttcgctcgatgtggacagcgggacggcgaagtttgacatcaacctgacctttatgaag
gaaggcgggcagttggtcgggtcgtttgagtacaacaccgatctcttcgaacgggcgacg
gtgtcccgtatgattggacactttagccgcttgctggaagtggctgccgcacagccggag
ctgtcgattgcggaattgcctttattgtcggcggaagagcgcacggagttgttgctggcg
gggaatgatctcacggcgcagttcccgcaggaaatctgcatccatgagcgttttgaacgg
caggcagagcgcacaccgcatgcggttgcggtggtgtatgaaggggagtctttgacctac
cgcgagctgaatgaacgcgccaaccaactggcgcactacctgcaaaagcaaggcgtcggg
ccggaagtgctcgtcgggctggcggtggagcggacgctggagatggtcgtcggtctgctt
gggatcttaaaagcgggcggggcttatgtgccgctcgacccgtcctatccgcaagatcgt
ctggcgttcatgctggaagactcgcagatcgccgtgctggtcaccgaggagcagcacctt
gcgacgctgcctgcgcatgaggcggttgcggtatgtcttgaccgtgatgcgctggagatc
gcgaaggaaagcgcggagaatcttgccagcggtgcaacgccggacaacttggcatacatc
atctacacgtcaggttcgacaggcaaaccgaaaggcgttttgatcccgcatgccaacgtg
ggccgtctctttgacgcgactgagcactggtaccattttgatgaaaaagatgtctggacg
gtcttccactcctatgcgttcgacttctcggtctgggagatctggggcgctctgttctac
ggcggcaaactggtcgtcgtcccgtattgggtgtcgcgctcgccggaagctttctatgag
ctgctggttgcggaacaagtcaccgtgctcaaccagaccccgtccgccttccgccagctg
atgcaggccgaagagcgtgcggcggaaaaagcgagcctggcgctgcgctatgtgattttt
ggcggtgaagcgctggagctgacttcgctgacggcgtggtttgagcggcacggggatgtg
acgccgcaactggtcaacatgtacgggatcacggagaccacggttcacgtcacctaccgc
ccgatcacgctggccgatgtcgagagcggggcaggaagcgtgatcggtgcgccgatccct
gacttgcaggtgtatgtgctggacgcgcatcatcagccggtgccatttggtgtcgcaggc
gagatgtatgtcggcggggcaggtgtggcgcggggatatctgaaccgcgcagatttgacg
gaggagcgctttatccgcaacccgtttggcgacgggcgcttgtacaagacgggcgacttg
gcccgccgtctggcgaacggggaattggagtactacgggcggatcgaccagcaggtgaag
attcgcggcttccgcattgagcttggggagatcgagtcggtgctggtgtcgcatccggct
gtgcaagaatgtgtggtcatggcgcgcgaagacgtgccgggcgacaagcgtttggctgcg
tatttcgtgggtaatgagcaagggacgctggagatcggcgagctgcgcagctatctgaag
gagcagttgccggagtacatgatcccgtccgcatttgtcgagatggacgtcatgccgctg
acggcgaacgggaagatcgacttgcgtgctttgcctgtgccggagcagtctgcggcggcg
atgcgcgagtacgtggcgccgcgcacggaaaaggaaaaactgctggcgatgatctgggcg
gatgtattgcgtgcagaccgggttggtgcggaagacaacttctttgagctcggcggccat
tccctgctggcgacgcaagtgatctcacgcgtgaacgaagcgtttggcgtgcagatgccg
ctgcgggtgctgttcgagtccccgacaatcgcggaattggcggagaacttggaaggtttg
gcagggacagcctcctcgcagcgcaccccgattgaaaaagtctcccgtgacgccgccctg
ccgctttcgttcgcgcagcagcggctgtgggtgatcgatcagctcatgccgggcagcgcg
gtgtacagcattccgtttgccgtgcgtttgcaagggcacttgcatgtggaagcgatggag
caaggcctgaacgagctgatctcccgtcatgagtcgctgcgcacgacgtttgtgaacgcg
gacggcggggcggtgcaggtgatcgcggagcccgtttggactgctctgcaagtgctggat
gtggagtcggaggcggatgtgcaggctttgattttggcagaagcgacacagccgttcgat
ctcacggccggcccgctggtgcgtttccgcctgctgaagctgggggcagaggagcatgtg
ctggtggcgaacatgcaccacatcatctccgacggctggtcgatcggcgtgtttacggag
gaatttgccgcgctgtatgaggcgttccgcaatggggagacttcgccgttgcaggatctg
ccgattcaatatgccgattacgccaactggcagcgcgagtggctgcaaggcgatgtgctg
gacgagcagctcgcgtactggaagggcaagctcggcggcgaactgcccgtgctgcagctg
ccgaccgaccgtccgcgcccgccggtgcagacgcatcacggcgcggtggagcggttccag
ctgtcggaagcgttgagtgaagcggtgcagaaactgtcgcagcagtatggggcgacactg
ttcatgaccctgctcggcgcgttccaagcgctgttgtcccgctacacggggcaggaagac
atcgccgtcggcacgccgatcgccggacgtcaccatggcgagacggaagggttgatcggg
ctgttcgtgaacactttggtcatgcgtaccgaccttggcggcaacccgacgtttgccgat
ctgttgtcccgcgtgcgggaaacggcgcttggcgcgtatgcgcatcaggatgtgccgttt
gaaaagctggtcgaagagctgcaaccggagcgcgacatgagccggacgcctctgttccaa
gtcctgttcgtgctgcaaaacgcccgcctgaccgacatcgagctgccggagcttgctctg
cagatgatcgacgcggacggcgggatggcaaaatttgatctggagctggcgatggaagag
caggagggacgcatcgccggtgcgctgaactacaacaccgacctgtttgatgccgacacg
atctcgcggatgatcgggcatttcgtgaccttgctggaaggggttgtgcaagagccgcat
gaggctctgtccgagctgccgttgctgactccggcggaagaaggtcaactgctcgacgag
tggaacggtgctctgctggatgttccgaacgcctgcctgcacaagctctttgaagcacaa
gcggccaagacgccggagcgcactgcagtcgtctttggggacgagagcctgacctacgca
gagttgaatgcccgggcgaaccgcctggcacaccatctgcaacagcatggtgtccgcccg
gatgtgctcgtcacgctctgcgttgagcgttcgctcgacctgatggtcggcgtgcttggg
atcttgaaagctggcggcgcgtatgtgccgctggacacttcgtatccggaagagcgcatc
aagctgattctggaagacacgcaagctccggtgcttgtaacgcaatcgcatctgcttgcc
aatcttccattatttaaaaatgagacggtctgcctcgacaccgattgggcggccatctcc
acgaagccggacaccaacccggtctctgccgcgaagtcgtaccaccttgcctacatgatc
tacacctcgggctccaccgggcgtccgaaagcggtcatggtcgagcacggcaacctcgtt
tccacgctgcaggcgagccaggagcgcttccgctttggggaagacgacgtgatgccgtgg
atcgcctcggtcgcgtttgacatcgcgctgttcgagtcgatgaacaccttgctccaaggc
ggcaccaccgtcattctcgcccgcgagcacgtgctggatctgccgagcctgatccaagac
ttgaaaggctacacggcgatccacaccgtcccaagcctgatgcgccagatcgtgcagacg
atgcgcgatggaggtgtgcccgcttcggagtacgacggcatgcgcctcgtcttcaccggg
ggcgacgccgttccgcccgacctgctcgacgagatgaaagaagtcttccgcaacgccgag
attcacgttctctacggcccgaccgaaggcacgatcatctgctcgaactaccaagtcccg
cgcggcgaaggtatgacccgcctgctgatcggacgccgcctcgacaatgcgaacctgcgc
gtgtacgatgcgaaccaacagctcgttccgatcggcgtccccggcgaactctacatcggc
ggctccggcgtcacgcgcggctactaccagcgcgaagaactgaacgctgaaaaatttgtc
accctcgcaggtgaccgctggtaccgcaccggcgacttggtgcgctatctggcagacgga
accctcgagttcctcggccgcatcgacaaccaggtcaaaatccgcggcttccgcatcgaa
atcggcgagatcgaagcggtgctcacccagcatccgcacgtccacgagagcgtcgtcatc
gtccacgaaagcgaaaggggcgacaaacgcctcgccgcctacctcgtcccggaagaaggg
gagagcgccgacaccgcagaactgcgcagctatctcaaagacaagctgcccgaatacatg
gtgccgtccttcctgatcctgctcgacgcactgccgctcaacccgaacggcaaaatcgac
cgcaaagcgctcccggcccccgacgccatggcgctggaagcgaccgtctacaccgccccg
cgcaccgaaacggaagcggtcgtagccggcatcttcgcggaagtgctgggcttggagcag
atcagcatcgacgacaacttcttctcgcttggcggccattcgctcctggcgacccaagtc
atctcccgcctgagcagcgcgcttggcacgcagatcccgctgcggcacctgttcgaagcg
ccgaccgtggccgattttgcaggaagtttgcagcttggagcggccaaccttgccatcgag
ccggtctcccgcgacggcgaactgccgatgtctttcgcccagcagcgcctgtgggtgatc
gaccaactgatgccggggcacaccgcctacaacatgccgcttgccgttcgcctgcaaggg
gagttggatgtgcaggcatttgaaaatgcgctgaacgacatcttgctgcgtcacgaagcc
ctgcgcaccacctttgccgaaaatgcggccgggctgcccgtgcaagtgatcgcagcgccg
gaatggcagattttgacccacatcgacctgcgcgaactttccgcagcagatcgtgaagct
gcggcacagcgtttagcgcaagaagacgccgaaacgccgttcgacctgaccgcagggccg
gtgattcgcttctccttgctgcagatggcggagaacgatcacgtcctgctcctgaacatg
caccacatcgtttcggacggctggtcgatgggcgtgtttgtcaaagaattcacccttctc
taccaagcgcacttgcgcggtgaggaggtcgtgctggctccgctgccgatacaatacgct
gattatgcccactggcagcgcgagaccctgtccggcgacaaactggacaccgagctacac
tactggaaaaatcagctcagcggcgaacttccgctgctgcagctgccgaccgatttggct
ggagaagaaacgcaggaaggcgcagacgtctccctgaccttgtccaaagagctgacagac
agcctgcaagcgctcagccagcgttacggagcgacgatgttcatgacgatccttggcgca
ttccagacgcttctgcatcgccacagcgggcaggaagacatctgcatcggcaccccgatc
gccgggcgcagcgccgtggagacggaagggatgatcggctttttcctgaacacgctggtc
atgcgcaccgatctgacgggcgcgccgaccttcgccgaactgctgggccgcgtgcgggaa
acggcgctcggagcgtatgcgcacgccgagctgccgtttgaaaaactagttgaggaagtg
cagccggagcgtcgtctgaaccgcaacccgatattcgacgtgctggtcaactacctcaac
atgccgcccctgcaagcggaactcccagaactgtccgtcacgccgctgccgtcggtggag
caggaagcgaaattcctgctgtccttgatcgtgcaggagcaggaaggagccgggcttggc
ctgcgtctgatctaccgcacctccttgttctcagaagcgcgaatcacggagatgttggcg
caattcgcagcattgctggaacagatcgcggtaaatccggatgtggcgatcaacgcctac
tcgctggtgaccgaagcatcccgcgccctgttgcccgatcaaaccgccgtgttcgacggg
ccagtctatccgtttgtgcaggatctgtttacggagtgggcagatcgaacgccggatcag
acggctgtctcacaaggggatcaggcgtggacgtacgcacagctcagctggcgcggagct
atccttgccgccgctctgcaagctcgcggcgtacagcaaggcgacgtggtcgcgatcctc
tccacgcgctgcttcggcctgatcgcgagcatgcttggcgtgctgaagagcggcggcgtg
ctgctgatgatcgacgaagacctcccgaccgcccgcaagcgcgtgatgctggaggagtcg
aaagcgaagcatgttctgcatatcacggagggtcaagcacaaggcgagatggccgaactg
ctcgccgcgtacgacgtgctgactgtcgatctgaacggggaaggggaaggggaaggggag
ttggagagccatgcgattgcatctgcattcgtgcagcccgacctttcgcctgacgacccg
gcctacattttcttcacctcgggaacgacgggcgtgcccaaaggcgtccttggccgccac
aacgggctcagccacttcctgatctggcagcgcgagacgtttaacatcgggccggacgac
cgttcctcgcagctgattcatctatccttcgacgttgtgctgcgcgacattttccttccg
ctgaccagcggggcgacattgtgcctgccggatcggatggacgatctcagcgctgagtac
ctgctgccgtggctggagcgtgaagaaatctcggttctgcacaccgtgccatcgctggcc
gcttcctgggtctcacaagctccggcaggcgtcacgctgtccgctctgcgctgcctgttc
acggcaggcgagcctttgaccgacgtgttggtcggcagatggcgtgaccgattcccgcag
ttgggcgatatcatcaatctctacggaccgaccgaaaccacgctggcaaaatgctactat
gttgtgccagagcaaccactgccaggcatccagcccgtcggcacgccgcagccaaacacg
caggtgctgatcctgaatgagcttggcgctctctgcggcatcggggaagcgggcgagatc
gtcatccgcacgccgtaccgctccttgggttatatcaacaatgcggaagagcaggcgaag
cgcttcgtcggcgatctgtacttcactggcgacaaagggcgttatcgcccggacggcctg
ctggaaatcctcggccgcgtcgacgatcaggtgaaagtgcgcggcgtgcgcatccagctg
aatgaagtgtcctcgacgctggctcgccatgctgctgttgatgcctgcacggtgctcgac
tggaaagatgagcagggcgaagtgaccctagtcgcttacgtagtgctgaagcaatcgcag
acgcttacgtccgccgagcttcgtgcgttcctgtccggccagcttttggctgcgatggtg
ccgtccgcgtttgtcttcctggagcaacttccgctgaccagcaacggcaaagtcgaccgt
aaagctctgccgcgtccagagcagttgagctatgaggaagcagcgtatgtcgcgccgcgc
acggagacggaagcgcagttggctgcgatctgggccgatgtgctgaaagcagaaggagtc
ggcgtcaccgccaacttcttcgatctcggcggccattcgctcttggcgacgcagatgatc
tcccgcgcccgccaggcgtttacggtggagttgaccctgcacagcctcttcgagcgtccg
accgtcgcccaactcgccgagctgatcgacgcctcccgcggactgcaagcggagggagcc
gcgcttgtgccggtcgtgcgtgacggcgatctgccgttgtcctacgcccagcagcgactc
tggttcctcgaccagttggagtcgaacagcgcggcttacaacatcccgctgatcctccgc
atagaaggagcgcttgacctgccgaccgtcgagcaaacaatgcaagaactggtgcgccgc
catgagaccctgcgtactacgtttgcagaaggcgaaggccaagccgtgcaaaaaatcgcg
cctgctgcgagtggcgcggtgcaagcgactctggagcagatcggtgcatctgcagcagaa
ctgtccgatagcactgtcacggttactgtgccgtttaatgtgcttcccgaagcggaagcc
ctcgcgttcctgcaacaggaagcgcagcgcccgttcgatctcagccatgggcagctgatc
cgtgcgaacgtggtcaaagtggcagacaacgaccacttcctgctgatcaacatgcaccac
atcatctccgacgcctggtcggttggcgtgctgctgaacgaatttgccgcgctgtacgaa
gcatttgcgaccggccatgcatcgccgctttccgaactggcgatccaatacgcggactac
gccgtctggcagcgcgaatggctgcaaggcgaccgtttgaccacacagctcgactactgg
aaacagcagctcggcgacgacgtgccgatcctgcagctgccgaccgaccgtccgcgcccg
ccggtgcagacgtttgcaggcgcgcagatcccgtttgccttgtccgaagagctgaccgac
ggcctgaactccttgagccgtcaaacgggcacctcgctgtacatgacgctgctcgctgcg
ttccagaccctgctgtcccgctataccgggcaggaagacatcgccgttggctcgccgatc
gcgggtcgtcagcgcaccgagctggaaggcttgatcggattcttcgtcaacacgcttgtg
ctgcgcaccgacctgtccggccagccgaccttccgcgacctgctgcagcgcgtccgccgc
acagcgctcgatgcgtacgccaaccaagacgtgccgttcgaaatgcttgtcggcgaactg
ggcgttgagcgcaacttgagctactcgcccttgttccaagtcatgttcgccctgcaaaac
gtgccgctcgccgaccgcgaagtggccgggctgaccctttccccggtgccgttcgaggtg
cagacatccaagttcgacttggcgatgaccctcgtcgagcaaggggagacgatcaccgga
gcgctcgatttcaataccgatctcttcgaccgggagacgatctcccgcctgatcgccaac
ttccagacgctgctcggcgcacttttggccgacccggactgcccgattggaaaattggct
ctggtcacgccggaagaagctcagcaactgcacgcatggaacgaaacgatggccgacttc
ccggcggagcgcacgattcaggaacagtttgccgaaatggtacgcctgcacccggaccgc
atcgccgtgtccgacggggagcagagcctgacttaccgcgaattgaacgaccgtgccaac
gcccttgcgcacgaactcctcgctcgtggtgtgcagccgaaccagttggtcggcttcatg
ctcgaacgcggcgtgcaggtgctggtcagcatcttcggcattttgaaagcaggcgcggct
tacatgccggtcgacgccgactatccggcagagcgcatcacctacatgctggaagacagc
ggcgcagtctggctgatcacgcagcagtccctgcaagagcgggcaaaagcgcttgcgccg
aacgtcctctgcctggaagacgttgcgcacggcaccgcgcttggcgacccggatgcggtc
aacacgccggacgacctcgcatacgtcatctacacctccggctcgacgggacgcccgaaa
ggcaccttgatgcgccacaccggcgtgctcaacctcgcccaatgggcacatgacacgctc
ggcgatacggagcacgatacgatcttgcagtactccaacaactcgtttgacgcttcggtg
caagaaatcttctgcgccctgctcaatggctcccgactgcatgtcctgagccaggatgag
cgtttgtcgatcgaagcgttcgccgacgcggtataccaaacgcaagcgaccgccgtcctg
ctcccgaccgtctttttccatcaggtcggcagctacttgtcggatcaagctgtgcaaaaa
ctcgcttcgctcaagcgcatcatcgttggcggcgaagcggtgagcagcgaatcggtgcgc
aactggcagcgccgtttcggcaccggcatggaagtgatcaacgcctacgggccgacggag
atcaccgtcatctgcaccgtttaccgcatgcaggagctgctgcccgatgaagtggtcaac
ctgccgatcggcaagccgatgtccaacttccagcactacatcctcaaccagcagttggaa
ctctgcccaatcggagtggtcggcgagctatacatcggcggtgtctccttggccaagggg
tatcacaaccagccggagaagacggccgaagtcttcctcccgcatccgttcctcgacggg
gcgcgggtctacaagacgggtgacttggcacgctggctgcccgacggcaacatcgaatac
atgggccggatcgaccatcaggtgaaaatccgcggtttccgcgtcgagctgaccgagatc
gaagaccgcctcggcaaacatccgtccctgcagcacgtcgtcgtgatcgcccgcgaccag
cgcctcgtcgcttatgtcgtgccgcagaagtcgcagagcgtcgacagcggcgcactgcgc
agctacttgaaagaaaaactgccggagtatatgatcccgtccgcgtttgtcgtgctggat
gcgctgccgctgactccaaacaacaaagtcgacctccgcgccctgccggcgccggaactc
tcgcaccttgtggagaccgattcctacgccgcgccgcgcaatgaggtggaagcggtgctg
gccgaagtgtggcagacggtgctgcgactggacaaagtcggcattcatgacaacttcttt
gaactcggcggcgactcgatcctgagcatccagatcatcaaccgcgcaggtctgcagggc
atccgcctcacgccgaaagacctgttccagagccagaccatcgccgagctggccgaacgc
gcccagacgggagccgctctgacaacggtcgacaacggcccggtcaccggaccggtgctg
ctgacgccgatccaacagtggttctttgagcaaaacctcgccgaccccaaccactggaac
atgtcggtgctgttcgaacttcgcgagcagctcgatgtggaaaggatgcgcgacgccgtt
tcccaactgctcacccaccacgacgcgctgcgcatgcgttacgaacaggtggcaggcgag
tggaagcaaacgatcctcgagccgggcggcgaagtgccgtttgtcaccgtcgacctgtcc
ggacgagaagacgcattcgaagccgaagcggacaactggcaaaagagcctgcagctcacc
gacggaccgatgctgcggttcgtccatgtggacttcggcggtacgcggaacagcatttta
cttctcatcgtgcaccatctcgtcatcgacggcgtgtcctggcgcatcctcctgcaagac
ttggaggcagcgtacagcaaacgccaactgccgccgaagacgacctccttccaaacgtgg
tcggagcgcttgtcccactacgcagcgacccctgcgattttgcaggaaaaagagcactgg
ctgcagctgcaagcaacacctgtcgccgagcttcctgtcgatcacgcccatggcgcgaac
accatcgggtcgggccgccgcatctccctgtcgctcacggcggaggagacccagcagctc
ctgcaggaagtgccgcaagcgtacaacacgcagatcaacgatgtgctgctgaccgcgctg
gtcgaagcgtttgccaaatggacgggcgagcgtgccttgctgctcgacttcgaagggcac
gggcgcgaagagatcggcgaagacatcgacgtgtcccgcacgatcggctggttcacgaca
atgtatccggtgctcctgcaactgcacgacaccgcagaagccggcccgcgcatcaaatcg
gtcaaagagcagctccgcgccatcccgaaccgggggatcggctatggtctgctgcgctac
ttgaacggcgaggaagcgctgcagaagatgcatgctgcacaggtttccttcaactacttg
ggacaatttgaccaagtgaccgaagcgtctgcgctgttccaagtctccaacttgccgggc
ggtgcgccgcgcgacgaagccaacccgcgccaccatctgctcgaaatcaacggcgcagtg
caaggcggccagctgcacatgagctggacgtacagcgccaatgtccacgagcaggcaacg
gtggaaaaattggcccagtccttcatgaacgaactccttgcagtgatccgtcattgcctg
tctgcagaagcgggcggattcacgccatccgatttcccggaggcgcggttgagccaagag
cgtctcgatgagctggtggcaagccttgccgagcgctccgtcacccgcacggacatcgaa
gcgatctaccaactgtcgccgatgcagcagggcatgattttccacagcatgatgtcgccg
gaagcgggcgtctatgtcgtgcagatgaacatggaactgcacggcacgctcgatgaatcc
gccctgcaacgggcatggcagaaagtgctcctgcgccacccgatcctgcgtaccggcttt
gagtggaaagggctggagaccccgcagcaagtggtctaccgtcatgtcaaactgccgatc
gaaacgctcgactggcgaggggagccgtccgccgatctggaagcgttcctgctccaagac
cgcattcgcggcttcgatttgtcgactgcgccgctgatgcgcctgaccctgatccgtctg
ggcgacagcatgtaccgtctggtctggacatcgcaccatctgctcttcgacggctggtcg
atgccgctggtgttcaaagagctcgtcaccgccttcgaagcggaagtgcgcggcaccgaa
gcgcagttcagcccgaaacgcccgtaccgcgacttcatcgcctggctgcaagagcaggac
atggcggcggcagaaaggttctggcgcggcaagttgtccggcttctccgcaccgaacagg
ctcccggtggagcgcacaagcccgcctgctacgacgccggccaagcgctacggcgagcaa
aaagtcaccttgtcggccagcacggcaactgcgcttcaagacgcggcccgtgcgcatggc
ctgaccttaaacacgctgttccaaggcgcttgggcgctgctgctcagccgctacagccgc
gagcaagacatcgtgtttggcgccaccgtctccggccgcccgaccgaccttgccggagcg
gactcgatgatcggcctgtttatcaacaccttgccgatgcgtctgcacaccgcgccggag
cagtcggtgttgagtttcctgaaagagttgcaggcgcagcaggtggaagtccgcgactac
gaatacaccccgctcgtgcaagtgcaagggtggagcgatgtgccgcgcgaccagccgctg
tttgagtcgattgtggtgtttgagaactatccgctcgatgagtcgatcgtcccggcgttt
ggcgatctggaagtcaaagagatgtcgacgctggagatggacagctacccgctcaccgtc
atggcgctgccgggggttgagtttacgatcaaagtcgcgtttgaccacctgcgttttgaa
gcggacgtcatcacgcgtctgatcgggcatttgcagacgctgctcctgtcgcttttggac
caaccggaggcaaggcttgccgatgtgccgatgctgtccgaagcggagcgtcaccagttg
ctggtcgattggaacgacaccgaggttgattacccgcaggatgaccgcatccacgagctg
ttcgaagcgcaggcaacgcgcacgccgagcgcctttgcggtcatccatggcacggaacag
ctcacctacgccgaactgaacgcccgcgccaaccagttggcgcaccgcctgcaacgcgtt
ggcgtcggcccggatgtgctcgtcggcatcgccgttgagcgctccttggagatggtggtc
ggactgctcggcattctgaaagcgggcggcgcgtacctgccgatcgacccggcctatccg
tcggagcgcatctccttcatgctggaagactcgggagttggcgtgctgctgacccaggga
catttgaccgcgtccttgccggagcatagggcagaggtgatctgcctcgacaccgactgg
gcagcaatcgcagaggagtctgctgaagcctgcgttagtgccggaactgccgacaacctg
agctacatgatctacacctcaggctccaccggcacaccgaaaggcgttttgatctcgcat
cgcgccgtggttaaccacaactttgccatctcgcgtgcatacgggcttggcgcgagcgac
cgcatcttgcagttcgcttcgatctcctttgacatcgcggtcgaagagctgttcccgacc
ttgctgtgcggagcgacgctggtcttgcgcggcgagcagatggcagcaggagacttcctg
cgctgggtggaggagcaaggcatcaccgtcctcaacctgccgaccgcctactggcacagt
tgggtgcacgaactggcgctccaatcggccgtgctgcccgcagcgcttcgcctgatgatc
gtcggcggcgaaaaagcatcgccagaagcgtatgccgtttggcaaaagctggccgggcag
cctgtgcgctggatcaacgcgtacggcccaaccgaagcgaccgtcaccgccacgatgtac
gaaccgagcggggaagaggcgcacgacgccttgaacctgcccatcggccgcccgatcgac
aacctgcagctgtacgtcctcgacgaacacttgcacccggttccggtcggcgtaccgggc
gaactgcacatcggcggtgccgggttggcccgaggctacctgaaccgcccggaactgacc
gccgacaagttcatcccgaacccgttcggcgcagcgggcacccgcctgtacaaaacgggc
gaccttgtccgctacctgcccgatggcaacctggaatgcctcggccgcaccgacgaccag
gtgaaagtccgcgggttccgcatcgagcttggcgagatcgaaaccctgctcgaagggcac
cctgccgtccaatcgggcgtcgtggtcgtccgcgacgaacgccttgttgcttactttgtt
ggcgacgatgcagccgacatccgcgcctacatgaaggagaaaatgccggagtatatgatc
ccgtccgcctttgtcgcattggatgaacttccgatgacgccaaacggcaaagtcgaccgc
cgcgccttgcctgcgccgggcactagcttcaccacaccgggcacaggcaccgagtatgaa
gagccgcgcaacaagacggagcaggcgctggccgagatctggcaaaacgcgctgcgccgc
gagcgggtcggcattcgtgacaacttctttgaactgggcggcgactcgatcctgagcctg
cagatcatctcccgcgccgcagcgaaaggcatccgcctgacgcccaaagacctgttcacg
caccagacgatcgccgagctggcccaagcggccggcaccgtctccggcgaacacatcgcc
gatcagggcgaagtgaccggggacgtgctcttcacgccgatccagcattggttcttcgag
gaagagatgcacaacgccaaccactggaacatgtcgatgctgttcgagacaagggagaag
ctggacgatgccattttgcaagacgttctggcccatctcctgcagcatcacgacgcgctg
cgcatgcagtttgcggacggcaagcaggtcagcgccgcttggagcggcgacgtcccgctg
acttctatcgacttgacgcatctgccgcttgacgagcaggaagcggcgttcgaagcggaa
gcaagccgactgcaaggaagcctcgacctgcaagccggtatgccggtgcgtttcgccgcc
tttacctttggggcggggctgccgagtcgacttttgctgatcgtccaccacttggtgatc
gacggcgtgtcatggcggattttgctggaggacttggagttggcctatacccagcgcctg
agtggtgcggagatcaaactgccgctcaagaccacgtcctaccaagcctgggcgaagcag
ctggccgactacgccaagtcgtccaccctgcagcaagagcgcaagtactggctccagcag
agccattccgctccgctgccgaccgaccttgctgcaggcgcgaacacggaagcgtccgcc
cagcacgtatcggtgaccttggatgcggcgcacacgcaagccctgctccaagaagcgccg
aaagcgtacaacacgcagatcaacgacctgctgctgaccgcgctggtcgaagcgtttggc
acgtggacgggcgagcgcgccctgctcttggatctcgaagggcacggccgcgaagagatc
ctcgatggcgttgacctgtcccgcaccgtcggctggttcaccgccgtctatccggtgtat
ctgaacctgaccgatgcaacacagccagggcagaagatccaaacggtgaaaaatcatctc
cgcgccatcccgaacaaaggcatcggctacgggctcctgcgctacctgaacggggatgcg
gcattggcggagctgccaagcgccgaggtgcagtttaactacctcggccagttggatcag
tcgctggcagagtctggcgtctttacggtttcgacagcagatggcggcgcgtcccgcgat
ccgcagaatccgcgcagccacctgttggagatcaactgcgccgtcaccggcgggcaactg
caggtcaactggacctacagcggcaacgttcacgataaggcgacagtggaaaagctggcc
gggcagtatctcgaagcactgcaggagctgatccgccattgccagtcgcccgatgagtgg
ctgaccgacgaagtgggcatccagtggaacctgtcctcgccaaactgcctgatgccgctg
aacaacgcccttaccggcactccgctgttcctcgtccatccggtcggcggcgtggcacag
atctacaccgagctggcgtatgagctgggcgaccgtcctgtatatggcctgcagtcccga
ggtttggacgaaagcgaaacgccgttcgccaccgtcgaagagatggcagcctgctacgtc
gacgcgatccgcactgtgcagccgtatggcccgtatcaagtgggcggttggtcgatgggc
ggtctggtcgcgctggaaatggcgcagcagttgcaagcggcaggggaggaagtcagcttc
ctcggcctcctcgacaccccggcccagcacctcggcggccacgacggccagccgaccccg
gtgcatcgcctgttgaccacattcgcggaagagctgacaggacgtttcggcatcgagatg
ccgggtgctgaagagctggcgcagacgctgaccgtcgatgagttcctgcaacagttcatc
acggcagccgcgcgcaccaaagctctgccgccgcacatcggcttggagcaggtcaagcgt
ttcttccgcgtcctgcaagccaacgatgcggccaactgcatctacgagcagcatttctac
gatggcaccgtcaccatgttccgcgccatcgaagacccgcagcaaggctccaaaggcctc
accttcggctgggatacagaagccagcaccgtccacgtccacaccgtacgaggcagccac
cacaacatggtgttgccgccgtatgtgaagatgctgggtgcgttgatgagagcttgtttg
gaggaatag

DBGET integrated database retrieval system