KEGG   Tumebacillus avium: CBW65_20310Help
Entry
CBW65_20310       CDS       T04874                                 

Definition
(GenBank) hypothetical protein
Organism
tum  Tumebacillus avium
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ARU63056
UniProt: A0A1Y0ITD4
LinkDB All DBs
Position
complement(4400715..4415396)
Genome map
AA seq 4893 aa AA seqDB search
MSEIELAAVTLVELLRLRKRQEPGETAYVFLSDNGEEERLTYAELDRKARALAALLQSRN
AQGERALLLYQPGIDYLIAFFGCLYAGVFAVPAYPPRQNGNLSRLQAVVADSRASFALAT
GKIAESVARRAAAEPELARLDWIVTDGLSEALADTWQEPQVTADTLAFLQYTSGSTALPK
GVMLTHGNLMHNLKLIETSFGTSRRSSGVVWLPPYHDMGLIGGILQPLFTGYPMTLMAPV
SFITKPLRWLEAISRTGATVSGGPNFAYELCVQKITPEQRDTLDLSSWENAFTGAEPIRQ
ETLDRFAEFFAPSGFRREAFYPCYGLAEGTLFVTGGMKQEAPIAQAFSASALKDHLVETA
ADEESAQVLVSSGRPALGNQEVLVVDPERRVPCADGHVGEIWVHGPSVAQGYWEREEQTR
ETFGAVLADTGRGPFLRTGDLGFLHEGELYITGRRKDLIIIRGRNFYPQDIEFTVQASHP
AIHNSNGAAFAVEVDGEERLVVVQEIERAHRKADLSAVIAAVREQVSQEHELQVYAVVLL
KPASIPKTSSGKIQRHKCKERFLEGSLEVVADSLAARAHAEAVRETEPAEVTLEMLTALD
AAGRQQRLEQDLLAKLAQVLHMHPSALSAEQPLTQWGLDSLMAVEVKNAVEEQLGLEVPF
ALLLEGVSVVELATELCRQVDEVCAKAAKMPDGKSAELCDGVADELSYGQQSLWFLQKLA
LESTAYHVARAVKLQADLDVPRLQRAFERLTERHEALRSVYVEADGAPQLKVQETAGDFF
AVEHAHGWTDEQMQARLSEAAKHPIDLEKGPLLQVRLFRREQESILLFHVHHIAVDFWTF
GVLLQEIGRLYAGAELPPVKAGYREYVQWQKALLCSPKGEALQAYWEQAGADLPLLQLSA
DRPRKKVQSDRGGRVRFALSAEMSDGLQALAREQGVTLYAALLAAYQVLLHRVTGEDDIV
VGSPTVGRSSAKFSETVGYFVNPVPLRTHVTGELPFAALLPAVKETVVSALLHQDYPFAL
MAERLQPDRDPSVHPLFQTLFTLQKSHLAQGEALGGFALGEAGAVFATGGLQVESMPFVQ
ESVQLDLALTMAWQDGRLTGVFDYRADLFDPLRIERLTEHFVTLLSGIVADAQAKIADLP
LLTAKQGEQVLAWKRQTVAFETDVLLHELFERQAARTPDAVAVVSEESHVTYSEMDTRAN
KLAHALAVRGVGPGQVVALCAERSVELVVGMLAVLKTGGAYVPVDPGYPAERIAYMIGDA
NPAVLLTQKHLRDALPVDGADVICLDDIHEAVDAWEANFVAANVTGDDPAYLIYTSGSTG
QPKGVVIPHRAIVNHMLWMQQEFPLTADDVVLQKTAFSFDASVWEFYAPLFAGATLVLAR
PGGQADPAYLVQAVQTYGVTTLQVVPSMLQLLLEEPNVEECVTLKRLFCGGEALTKGLVQ
QFHARLSGQLVNLYGPTEAAIDTTFWVCEPDDGPGDVPIGKPIANAEVYVLDAALHLVPV
GVPGELYIGGAGLALGYFKQLEQTAQKFIPNPFGAGRLYRTGDSVRWREDGALEFLGRLD
DQVKLRGFRIELGEIEAVLRRHDGVQEAVVVVRDQRLAAYLTGAGDIGLHAYLKGNLPDY
MVPSALVWLEHLPLTANGKVDRKALPAPEWTGAGEAAFVVPRTETEAGVAAIWQEVLGVE
QVGAEDNFFALGGHSLLAAKIVSRINRRFDVDLPLRTLFAAPTVAELAAEVHTLAGSGMT
PLVPILREGALPLSFAQERLWFIDRLEGASALYNIPGAVRLSGALDVSALERSLQEIVAR
HEALRTIFTVVDGQAVQQIKDGADFTLAVADSAEEDVQSHASTEATVPFDLEKGPLLRAK
LLRLADDEHVLILAMHHIVSDGWSLGVLLRELSALYAACLQQEPSPLQPLAVQYADYAVW
QQQNVQGAELDKQLAYWKHKLSGELPVLQLPTDRPRPSVQTANGDVLSFALPATLTAQLR
ELAAGADGTTLFTLLLTAYKTLLYRYTGTEDLRVGTPVAGRTQVELEPLIGFFVNTLVLR
DKVDGSMTFRQLLEQVKTTALEALAAQDVPFEKLVEELQPERSLSHSPLFQAMFTWQPSP
LAELNLPGVSHRQVEMHSRTAKFDLTLMMEDRDGLLTGMIEYRTDLFDKETIARIAGHFQ
TLLQAAVLDPDLPLAQLPMLTAEEQAQLALWNDTERLDALKIGVHQWFEKQADATPQQVA
LLFGESSLTYRELNERANSLARRLQKLGAGPGQMVGLCMERSLELIIGMLAILKAGAAYV
PFDADYPADRLRFQLEDAKVSLLLTQERMLAKLSEHGAQTLCVDGFCTEEGAEEGTENLG
IAADPDDLAYVMYTSGSTGQPKGVMVPHRGVVRLVKDTDYVQFSEHDVFLQFAPVAFDAA
TFEIWGALLNGAQLVIFPPGQASLGELGRVIQGYGVTTLWLTAGLFHQMAEHHLDGLRGV
RQLLAGGDVLSVPHVQTVVERLDCRFINGYGPTECTTFAVCHEVQKQDLSLPSLPIGRVI
ANTTALIFDQDGQAVPVGVPGELHIGGAGVALGYLNRPELTAERFVNTAEHGRLYKTGDM
VRRLADGTMEFLGRTDHQVKVRGYRIELGEIEAAIAKHPSVHEAVVLVREDSPGDQRIVA
YVTMEATADGTGELRRHLKDKLPSYMVPQHIVAVEAFLLTANGKIDRRALPAPLMTEGER
EYTAPRTALEERLCSLFEEVLHTSPIGIHDDFFAAGGHSLLATQAVTRIQAAFGIDLPLR
KLFEAPTAAELAVVINETALGANEAASIVPTARAGHVPMSFAQERMWLLNQLLADSSAYH
ISGAVRMRGPLDRSALTRSLHTIVERHEALRTSFNVVNGQAVQLVRRELAVEIPLTDLTS
LPEDEREEAALQLALEQARQPFDLTGDALVRLSLICLGDDDHLLVMVMHHIISDGWSLGV
LLQELSVLYGGRELPELAVQYADYAQWQRNWLQGETLEQQLEYWKRKLGGSLPLLQLPAD
RPRPAVQTTKGAQLAFAIPKELTARLKELGQTGGETLYMTLLAAFKVLMFRYTGQDDIAV
GSPVAGRNRVEIERLIGFFVNTLVLRSDLSGEPAFRDLLAQVKQTALEAYAHQDVPFEKL
VSVLQPERNSSHTPLFQVLFALQNAPMQIELPGLAIERLNLDNQTAKFDLSLLLEEADEE
LSGMFEYNTDLFEEATIKRLAGHFRTLLQGIVADPGQKITELPLLTRAEAEQLSGVKGGA
REFAPLCLHELFERQAARTPDAPAILSAAGVLSYSELNARANRLAHYLQGQGGGPDGLIA
ICMERSPELLIAILAVLKAGAAYVPIDPAYPQDRISFLLADGGAPLLLTESHVLAELPAH
TATAVCLDRDGELFAGLGTDNPRTAAQPHHLAYIIYTSGSTGKPKGVAIEHRNASSFIQW
AHEVFSPEELQGVLFSTSVCFDLSIFELFAPLSCGGQVILAQNALQLPMLAAKEQVTMIN
TVPSAIAELLRLQAIPASVKVVNLAGEPLKLDIVERLYEIGTLEKVYNLYGPSEDTTYST
YELMQRGSQAKPLIGMPIAGTQAYLLDANLQPVPVGVPGELFLGGAGVARGYLGRPELTA
EKFMRDPFSGRPDGRMYRTGDLVRALPDGRLDYLGRLDHQIKLRGFRIELGEIEAALLKH
HAVRETVVMVREDRADEKRLAAYLVLEAGVELTTAELREHAGRTLPSYMIPSAFILLEAM
PLTSNGKIDRKALPVPEGASVGSSAAYAAPQSEQEERLAAIWRDVLKRERIGIDDNYFEA
GGDSILAIQVLTRAREAGLTFTMPQLFQHQTIRELAQEILLADAVPGGEVIPQPYGLLTA
ADRAKLPQGVEDAYPLTMLQGGMLFHSLYGAEQAAYHNVTSLRLRLPFAEAKMRQALERL
LQRHAVLRTSFVMTGYSEPLQLVQSQVELSFAIRDLRGLTAPEQEQHVQEWLDAESRAYF
DVTHAPLMRFHVDRLRDDEMQFTITYHHGILDGWSLATLTTELFGMYLDKGVKDAPRGLF
RRFVDLERQALASEEAQGFWLHLLDEFTVTEVPAVEAPDDSQELYRSVEVEIGEALQQGL
QRAARQAAVPLKSTLLVGFLRTLSLYSGQTDVLTGVVVNGRPEVQDGERALGLFLNTVPY
RLQLQEGSWLHLLQETFAAERSILPHRRFPMATLQQKLGGQPLFDSAFNFVNFHVLSDLA
GELEVLSMQESGHTNYPLVAEAGLDPETGRMTLALRYNTKAYGQGQVERMAHSFRAALQQ
MALAPESAHATAVLLEEDQLKQLAVWNRTGSLEDAECLHRLVEAQAQHTPDACALVTEAE
RLTYRELNERANRLAHRLQKLGAGPDVRVAVCLERNASLVIALLAVLKAGAAYLPLDPAY
PEERIEFLLQDAGAALVITDSALGVKCPATAAAQLCLDLEQELLADEPWDNPRSTVTPSH
LAYVIYTSGSTGLPKGVGVEHRSVSAMLQATFALYAKEDFAACLFSTSVCFDPSVLELFA
PLSLGGTVILAENALHLPHLQAKDEVTMFTAVPSAVTELLRQQSIPASVRTVNMGGEMVK
GPLVQELYQLGHIEKVYNMYGPTESTVYSTLELCERGGSHSPPIGKPIPGTRAFVLDEFL
QPAPIGVPGELFLSGAGLARGYLGRPELTAERFLPHPLAQGERIYRTGDRVRRLPDGRLE
YLGRLDHQVKVRGYRIETGEIEAALMQHPAVLEAAVLVREDAPGGKQIVGYVVLQTGEFL
TMSDLRAAIKVRLPDYMVPSLLVTLDALPLTPNGKVDKKALPAPDLAQIRETPYVAPRTD
LESRLCAIWEQLLGVEQVGVHDNFFDLGGHSLLATQLVSRVREVFAVELALRDLFAARTV
EQFAAVVEAAGQTANETMTIAKSANRKTRTRSR
NT seq 14682 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagattgaacttgctgctgtcacgttggtggagcttctgcgcttgcgcaagcgg
caggagccaggtgaaacagcgtatgtatttttatctgacaatggggaagaagagcgtctg
acctatgcggagctggaccgcaaagcgcgggcgttggcggcgttgctgcaaagccgtaac
gcgcagggcgagcgcgcgctgttgctttaccagccggggatcgactacctgatcgccttt
tttggatgtctgtatgcgggcgtgtttgccgtgcccgcgtatccgccgcgccaaaacggg
aacttgagccgcctgcaggcggtcgtcgccgactcgcgggcatcgtttgctctggcgacc
gggaagattgcggagagcgtggcccgaagggctgctgcggagccggagctggcccggttg
gattggatcgtcaccgacggtctgtcagaagcgctggccgatacgtggcaggagccgcag
gtgacggccgacacgctggcctttttgcaatacacatccgggtcgacagcgctgccgaaa
ggggtcatgctcacgcatggcaacttgatgcacaacttaaagctgattgaaacgtcgttt
ggcacgtcccgccggagcagcggggtggtctggctgcctccgtatcacgacatgggcttg
atcggcgggatcttgcagccgctgttcaccggttatccgatgaccttgatggcgccggtg
tcgtttatcaccaaaccgctgcgctggctggaagcgatctcccgcaccggggcaacggtc
agcggcgggccgaattttgcttacgagctgtgtgtgcaaaaaatcaccccggagcagcgc
gacacgctggatctctcttcatgggaaaacgcgttcaccggagcggaaccgattcgccaa
gagacgctggaccgctttgcggagttttttgctccgagcggttttcgcagagaagcgttt
tacccgtgctacgggctggcggaaggcacgctgttcgtcacgggcgggatgaaacaggaa
gcgccgatcgcgcaggcgttttcggcgtctgcgctcaaagaccatctcgtggagacggca
gctgacgaagaaagcgcacaggtgctggtctcgtccggtcgtccggcgcttggcaatcag
gaagtgctggtcgtcgatccggagcggagggtgccttgtgcggacgggcatgtcggcgag
atctgggtgcacggaccgtcggtggcgcaagggtattgggagcgcgaagagcagacccgc
gagacgtttggcgcggtgctggccgatacgggaagaggaccgtttttgcggacgggcgat
ctgggatttctgcatgaaggcgagctgtacatcacgggccgccgcaaggatctgatcatc
attcgcgggcgcaacttctacccgcaggacatcgaatttacggtgcaagcaagccatccc
gccattcacaacagcaacggcgcggcttttgctgtcgaagtggacggggaagagcggctg
gtggttgtgcaggagattgagcgcgcgcaccgcaaagccgatctgagcgccgtgatcgcg
gccgttcgcgagcaagtgtcgcaggagcatgagctgcaagtttatgcggttgtcctgctc
aagccggcgagcatcccgaaaacatcgtccggcaagattcagcgccacaaatgcaaggag
cgctttctggagggatcgctcgaagttgtcgccgattcgctggcggcacgcgcccatgcg
gaggctgtgcgcgagacggagccggcggaggtgacgctggagatgctgaccgcacttgac
gcggcggggcggcagcagcggttggaacaggacctgctggccaaactggcgcaggtgctg
cacatgcacccgtccgcgctgtcggccgaacagcctttgacgcagtgggggctggattcg
ttgatggcggtcgaggtgaaaaacgcggttgaggagcaattgggcttggaggtgcctttt
gcgctgctgttagaaggcgtatccgttgtcgaactggccaccgagctgtgcagacaggta
gatgaggtgtgcgccaaggcggcaaagatgcctgatgggaagtccgctgaactgtgcgac
ggagtggcggatgaactgtcgtacggtcagcagtcgctgtggttcctgcaaaaattggcg
ctggaaagcacggcttatcatgtggcgcgggcagtgaaactgcaggcagatctcgatgtg
ccgcgtctgcagcgcgcatttgagcggctgacggaacggcatgaggcgctgcgctccgtc
tatgtggaggcggacggcgcaccgcagctcaaggtgcaggagacggccggggactttttt
gcggtcgaacatgctcacggctggacggatgagcagatgcaagcgcggttatcggaagcg
gcgaagcatccgatcgatctggaaaaggggcctttgttgcaggtgcggctgttcaggcgc
gaacaagagagcattctgttgttccatgtgcatcacatcgcagtcgacttctggacgttt
ggcgtgctgctgcaggagatcggccgcttgtacgcaggggcagaacttccaccggtcaag
gcgggctatcgagagtatgtgcagtggcaaaaagcactgctttgcagcccgaaaggcgag
gcgctgcaggcgtattgggagcaggcaggagctgatctgccgctgttgcagctgtcggca
gaccgcccgcgcaaaaaggtgcagagcgaccggggcggacgcgtgcgctttgcgttgtcg
gccgaaatgagcgacgggctgcaggcgttggcgcgagagcagggcgtgacgctctatgcg
gcgctgttggcggcgtatcaggtgttgctgcaccgcgtgacgggcgaggacgacatcgtg
gtcgggtcgccgacggtcgggcgcagctcggccaaattttccgaaacggtcggctatttt
gtcaatccggtgccgctgcggacgcacgtgaccggggagctgccgtttgcggcgttgttg
ccagcggtgaaggagacggtcgtatcggcgctgctgcatcaggactacccgtttgctttg
atggcggaacggttgcagccggaccgcgacccgagtgtgcacccgctgttccagaccttg
ttcaccttgcaaaagtcgcatctggcgcaaggggaagcacttggcggatttgcgcttggc
gaggcgggggcggtgtttgcaacgggaggcttgcaggtggaatcgatgccgtttgtgcag
gagtcggtgcagctcgatctcgcgctgacgatggcctggcaggacggcaggctgaccggg
gtgtttgattatcgggccgacctgtttgacccgctgcgcatcgagcggctgacggagcat
tttgtgacgcttttgagcggcatcgtggcggacgcgcaggcgaaaatcgccgatctgccg
ctgctgacagcgaagcaaggcgagcaagtgctggcgtggaagcgccagacggtggcgttt
gagacggacgtgctcctgcatgaactgtttgagcggcaggcggcgcggacgccagacgcg
gtggcggtcgtgtcggaagaaagccatgtcacttattccgagatggatactcgggctaat
aaactggcccatgcacttgcggtgcgtggcgtcgggcccgggcaggtcgtggcgctgtgc
gcggaacgttcggtggagctggtcgtcgggatgctcgccgtattaaaaacgggcggggcc
tatgtgccggtcgatccgggctatccggcggagcggatcgcctacatgatcggcgatgcc
aacccggccgtgctgttgacgcaaaagcatttgcgggacgctttgcctgtcgacggggcg
gacgtgatctgcctggacgatattcatgaagcggttgacgcctgggaagcgaactttgtt
gccgcgaatgtgaccggggacgacccggcttatctcatctatacgtccggttcgaccggc
cagccaaaaggggtcgtgatcccgcatcgggcgatcgtcaatcacatgctctggatgcag
caggagttcccgctgaccgccgatgatgttgtgctgcagaagaccgcgtttagttttgac
gcatcggtgtgggagttttacgcgccgcttttcgccggtgcaacgctggtgctggcgcgt
ccgggcgggcaggctgatccggcttatctggtgcaggcggtgcagacgtatggcgtgacg
accctgcaagtggtgccgtcgatgctgcaactgctgctcgaggagccgaacgttgaggaa
tgcgtgacgctgaaacggctgttctgcggcggcgaagcgctgacgaaaggtcttgtccag
caattccatgcgcgcctctccgggcaactggtgaacctgtacggcccgacggaagcggcg
atcgacacgacgttttgggtctgcgaaccggatgatgggccaggcgatgtgccgatcggg
aagccgatcgccaatgcggaagtgtatgtgctcgatgcagcgctgcatcttgtcccggtc
ggcgtgcctggcgaactgtacatcggcggggcagggcttgccttaggatatttcaagcag
ttggagcagaccgcacagaagttcattcccaatccgtttggggcgggacgcttgtaccgc
accggcgacagcgtgcgctggcgggaagacggggcgctggagtttctgggccgcctcgac
gatcaggtgaaactgcgcgggttccgcatcgaactcggcgagatcgaagcggtgctgcgc
agacacgatggagttcaagaagcggtcgtcgtggtgcgtgaccagcgtttggcggcgtat
ctgacgggagcgggtgacatcggcctgcacgcctatttgaaaggaaacctgccggactac
atggtgccgtccgcgttggtctggctggaacatctgccgttgaccgcaaacggcaaagtg
gatcgcaaagcgttgcccgcgccggagtggacgggcgcaggtgaagctgcttttgttgtg
ccgcgcacggagacggaagccggggtcgcggcgatttggcaagaggtgctcggcgtggag
caggtcggggcagaggacaacttttttgcccttggcggacattcgctgttggctgccaag
atcgtctcgcgcatcaaccgccgctttgacgtcgacctgccgctgcgcacgctgttcgca
gcgccgacggtggcggagttggcagcagaggtgcacactctcgccggaagcgggatgacg
ccgctcgtgccgatcctccgggaaggtgcgttgccgctctcgtttgcgcaggagcgtttg
tggtttatcgaccgcttagaaggggccagcgccttgtacaacattccaggtgcggtgcgt
ttgtccggcgcgttggacgtgtctgcgctggagcggagtctgcaggagatcgtggcccgt
cacgaggcgctgcggacgattttcacagtcgttgacgggcaggctgtgcagcagatcaag
gacggtgcggacttcacgttggctgtggccgacagcgccgaggaagacgtgcaaagccac
gccagcacagaagcgacagtgccgttcgatctggaaaaagggccgctgctgcgcgcgaaa
ctgctccgtctggcagatgacgaacatgtgctgatccttgcgatgcaccacatcgtgtcg
gacggctggtcgcttggcgtcctgctgcgcgaactgtccgcgctgtacgctgcatgttta
cagcaggaaccgtcgccgctgcagccgctggccgttcagtatgccgattatgccgtctgg
cagcagcagaatgtgcagggcgcggagctggacaagcaactggcgtactggaagcacaag
ctgagcggagaactgcccgtgctgcagttgccgaccgaccgcccgcgaccgtctgtgcag
acggcgaacggggatgtgctgtcctttgcgttgcctgcgacgctgaccgcacaattgcgg
gaactggcagcaggcgcggacggcacgacgctgttcacgctgttgctgaccgcctacaag
acgctgttgtaccgctacacgggaacggaagacttgcgggtcggcaccccggtcgccggg
cgtactcaagtggagcttgagcccttgatcggcttttttgtcaacacgctcgtacttcgc
gataaggtcgacggcagcatgacgttccgccaactgctggagcaggtgaaaacgaccgcg
ctggaagcgttggccgcgcaggatgtgccgtttgaaaagctggtcgaggagctgcagccg
gagcggagcctgagccattcgccgctgttccaggcgatgtttacctggcagccgtccccg
ctcgcagaattgaacttgcctggtgtctcgcatcgccaagtcgagatgcacagcagaacg
gccaaatttgacctgacgctgatgatggaagatcgcgacgggctgctcaccgggatgatc
gaataccgcaccgacctgtttgacaaggagacgattgcccggatcgccggccacttccag
accttgctgcaagcggcggtgctcgatccggacctgccgctggcacaacttccgatgctg
actgcagaggagcaggcgcaattggcgctgtggaacgacacagaacgtttggatgcattg
aagattggcgtgcaccaatggtttgaaaagcaggcagacgcgactccgcagcaagttgcc
ctgctgtttggagagagcagtctcacctaccgtgaattgaacgagcgggccaactccctc
gcgcgtcgattgcaaaagctcggcgcgggtccggggcagatggtcggcctgtgcatggag
cgctcgttggagctgatcatcggtatgctcgcgattctcaaagccggcgcggcgtatgtg
ccatttgatgcggactacccggccgaccgtctgcgcttccagttggaagatgccaaggta
agtcttttgctgacccaagaacgtatgctggcgaaactgtcggagcacggagcgcaaacg
ctgtgtgtggacggtttttgcacagaagaaggggcagaagaaggcacagaaaatctcggc
atcgctgccgaccccgacgatttggcttatgtgatgtacacatccggctcgaccgggcag
cccaaaggggtgatggtgccgcatcgcggcgtggtgcggctggtgaaagacaccgactat
gtgcagttctcggagcatgacgtgttcctgcagtttgccccggtggcgtttgacgctgcg
acgtttgagatctggggtgcgctgctgaacggtgcacagctggtcatcttcccgccgggc
caagcatcattaggagagctgggacgcgtgatccaagggtatggggtgaccacgctgtgg
ctgacggccgggctgttccatcagatggcggaacatcacctcgatggcctgcgcggtgtg
cgccaactgctggcgggcggagatgtgctgtcggtgccgcatgtgcagacggtggtcgag
cgtctcgactgccgtttcatcaacggctacgggccgaccgagtgcacgacttttgcggtc
tgccacgaggtgcaaaaacaagatttgtccttgccttccttgccgatcgggcgtgtgatc
gccaacacgaccgctttgattttcgatcaggacggacaggcagtgcccgtcggcgtgccg
ggtgaacttcacatcggcggggccggggtggcgctgggctatctgaaccggccggagctg
accgccgagcggtttgtcaacacagctgaacatgggcgtctctacaagacgggcgacatg
gtgcgccgcctggcggacggcacgatggagttcctcggccgcaccgaccatcaggtgaaa
gtgcggggttaccgcatcgagctcggcgagatcgaagcggcgatcgccaagcatccgtcc
gttcacgaggcggtcgtgctggtgcgtgaagacagccctggcgatcagcgcatcgtcgct
tacgtcacgatggaggcaacggcagacggcacgggtgaactgcgccgtcatttgaaagac
aaactgccgtcgtatatggtgccgcagcacatcgtggcggtggaggcgtttctgctcacc
gcaaacggaaaaatcgaccgcagagctttgcctgcacctctgatgacggagggggaacgc
gaatacacggcaccgcgcacagctctggaagagcgcttgtgctccctgttcgaagaggtg
ttgcacacctcgccgatcgggattcacgacgacttttttgccgcaggaggccactccttg
ctggcgacgcaggcggtgacgcgcatccaggctgcttttggcatcgacctgcccttacgc
aagctgtttgaagcgccgacggcggcagaactggccgtcgtgatcaacgagacggcgctt
ggggcaaacgaagcagcttctatcgtgccgaccgcgcgcgcagggcatgtgccgatgtcg
tttgcgcaggagcggatgtggctgttgaaccagttgctggccgattcgtccgcctaccac
atctcaggtgcggtcaggatgcgcgggccgttggaccggtctgctctgacgcgcagtttg
cacacgattgtcgaacggcacgaagcgctgcgcacttcgtttaatgtggtgaacgggcaa
gcggtgcaactggtgcgccgtgaactggcggtggagattccactgaccgacctgacctcg
ctgccagaggatgagcgggaagaggcggcgttgcaactggcgctggaacaggccagacag
ccgtttgatctgaccggagatgcgctggtgcggctctctctcatctgtctgggtgatgat
gatcacctcctggtgatggtcatgcaccacatcatctctgacggctggtcgcttggcgtg
ctgctgcaggagctgtccgtgctgtacggcggccgcgagttgccggagctggccgtgcag
tatgcagattatgcccagtggcagcgcaactggctgcaaggcgagacgctggagcagcag
ctggagtactggaaacggaagcttggcggctccttgcccctcttgcagctgcctgccgac
cgtccgcgccctgctgtccagacgaccaaaggcgctcagctggcttttgccatcccgaag
gagctgaccgcaaggctgaaggagttggggcagacaggcggggagaccttgtacatgacc
ttgttggccgcgttcaaggtgctgatgttccgctacacgggtcaggacgacatcgcagtt
ggttcgccggtcgccggacgcaaccgggtggagatcgaacgcctgatcggattttttgtc
aatacgctggtcttgcgcagcgacctgtcgggcgaaccagcttttcgcgacctgttggca
caggtgaaacagacggcgctggaagcgtatgcccatcaggacgtgccgtttgaaaagctg
gtcagcgtcttgcagccggagcgcaatagcagccatacgccgctgtttcaagtgctgttt
gcgctgcagaatgcgccgatgcagatcgaactgcccggacttgccatagagcggctgaac
ctcgacaaccaaacggccaaattcgacctctccctgctgctggaagaggcggatgaagag
ctgagcggcatgtttgaatacaacaccgacctgtttgaggaagcgacaatcaagcgcttg
gccggccatttccgaactttgctgcaaggcatcgtcgccgatccggggcaaaagatcacc
gaactgcccctgctgacccgggccgaagcggaacagctctccggggtgaaagggggggcg
cgcgagtttgcgccgctctgtctgcacgagctgtttgagcggcaagccgcacggacgccc
gacgcgccggcaattctgtctgcagcgggcgtgctgagctatagcgaactcaatgcgcgc
gccaaccgccttgcgcattatctgcaagggcaggggggcgggccggacgggctgatcgcg
atctgtatggagcggtcgccggaactgctcatcgctatcttggcggtgctgaaagcagga
gctgcctatgtgccgatcgacccggcttatccgcaagaccgcatctcgtttctgctggcc
gacggcggagcgccgctgttgctgaccgagtcgcacgtgctggccgagctgcccgcgcat
acggcgacagcggtctgcctcgaccgcgacggggaactttttgcagggcttggcacggac
aatccccggactgcagcacaaccgcatcatcttgcctacatcatctatacgtccggttcg
acaggcaagccaaaaggggtcgccatcgaacaccgcaacgcatcgtctttcatccagtgg
gcgcatgaggtgttttcgccggaggagctgcaaggcgtgctgttctcgacctcggtgtgt
tttgacctctcgatctttgagctgtttgcgccgcttagctgcgggggacaggtgatcctc
gcgcaaaatgctttgcaattgccgatgcttgccgccaaagagcaggtgacgatgatcaac
accgtgccgtccgccatcgcggagctgctgcgcttgcaggccatcccggcgtcggtcaaa
gtggtcaatctggcaggtgagccgctgaagctcgacatcgtggaaaggctgtacgagatc
ggcacgctggagaaagtctacaacctctatgggccgtctgaagacacgacatactctacg
tatgagctgatgcagcgtggatcgcaggcaaaaccgctgatcgggatgccgatcgccgga
acacaggcgtatctgctcgacgccaacctgcagccggtgccggtcggggtgccgggcgag
ctgttcctcggcggggccggggtggcgcgcgggtatctggggcggccggagctgaccgcc
gagaaatttatgcgcgatccgttctccggacggccggatggcaggatgtaccgcaccggt
gacctggtgcgcgccctgccggacggacgcctcgattatctgggccgtctggatcatcaa
atcaagctgcgcggattccgcattgagctgggcgagatcgaggccgcgctgctgaagcat
catgcggtgcgggagacggtggtcatggtgcgcgaagaccgtgcggatgaaaagcgactg
gccgcctatctcgtcctcgaagcgggagtggagctgaccacagccgaactgcgcgagcat
gccggacgcaccctgcccagctacatgatcccttccgccttcatcctgctggaggcgatg
ccgctcacatcgaacggcaaaatcgatcgcaaggcgctccccgtgccggagggagcgagc
gtcggcagcagcgcggcgtacgcagctccgcaaagtgagcaggaggagcgtttggccgcg
atctggcgcgatgtgctgaaacgggagcgaatcggcatcgacgacaactattttgaagcg
ggcggcgactcgatcctcgcgattcaagtgctgacccgtgcccgcgaagccgggctgacg
tttacgatgccgcagttgttccagcatcagacgatccgcgaattggcgcaggagatcctc
ttggcggatgccgttccgggcggggaagtcatcccgcagccgtacgggctgctcaccgcc
gctgatcgggccaagttgccgcaaggggtcgaggacgcgtacccgctgacgatgctgcag
ggaggcatgctgttccacagcttgtacggcgcggaacaggccgcctaccacaacgtcacc
tcgctgcgcctgcgcttgccttttgcggaagcgaaaatgcggcaggctctggagcgcctg
ctgcagcgccatgccgtgttgcgaacttcgtttgtgatgaccggttacagcgagccgttg
cagctggtgcagtcgcaagttgagctgtcgtttgcgatccgcgacctgcgcggcctgacc
gctcctgagcaggagcagcatgtgcaggagtggctggacgcggagagccgcgcgtatttt
gacgtgacacacgcgccgctgatgcgcttccatgtcgatcgtctgcgcgatgacgagatg
cagtttacgattacctatcaccatggcattctcgacggatggagcttggcgacgctgacc
accgagctgtttggcatgtatctggacaaaggcgtgaaggatgcgccccgcgggctgttc
cgcagatttgtggacttggagcgccaggcgctggcgtctgaggaggcgcaagggttctgg
ctgcatttgctcgatgagttcaccgtgaccgaagtgccggcggtggaagcgcccgacgac
agccaggagctgtaccgcagtgtggaggtcgagatcggggaagcgctccagcaaggtctg
caacgggcagcccgccaagcggccgtaccgttgaaaagcacgctgctggtcggcttcctg
cgcacgctcagcctgtatagcggtcagaccgacgtgctgaccggcgtggtggtcaatgga
cgtccggaagtgcaggacggagagcgagcgctggggctgtttctgaacaccgtgccgtac
cgcctgcagctgcaggaaggcagttggcttcatctgctgcaggaaacatttgctgccgag
cgctccatcctgccgcatcgccgcttcccaatggcgacgcttcagcaaaagctgggcggg
cagccgctgttcgactcagcatttaacttcgtgaacttccacgtgctgagcgacctggcc
ggggagttggaagtgctgtcgatgcaagagtctggccacaccaactatccgctggttgct
gaagcgggcctcgacccggagaccggccggatgacgcttgccttgcgctacaacacaaaa
gcgtacgggcaggggcaggtcgagcgcatggcgcacagcttccgggcagctctgcagcag
atggcgttggcgccggaatccgcacatgcgaccgccgtgctccttgaggaagatcagctg
aaacaactggcggtgtggaaccggacgggcagcctggaagacgcagagtgcctgcaccgt
ctcgtggaagcgcaagcccaacacacgccggacgcttgcgcattggtcacagaagcggag
cggctgacctaccgggagttaaacgagcgtgccaaccgccttgcgcaccgtctgcaaaag
ctcggtgccgggccggacgtgcgcgtcgccgtctgtttggagcgcaacgccagcctcgtc
atcgcgctgctggccgtgctcaaagcaggagctgcctacctgccgctcgacccggcctat
ccggaggagcgcatcgagtttttgctgcaggatgcgggggcggcgctggtcatcaccgat
tcggcgctgggagtcaaatgcccggcaactgcggcggcgcagctctgcctcgacttggag
caggaactgctcgcagacgaaccgtgggacaatccaagatcgacggtgacgccaagtcac
cttgcctacgtcatttatacatccggctcaaccgggctgcccaaaggcgtaggagtcgaa
caccgcagcgtttcagccatgctgcaggcgacatttgctctgtatgccaaggaggatttt
gcagcctgcctgttctcgacgtctgtttgcttcgacccgtcggtgctggaactgttcgcc
ccactcagtctgggcggcaccgtcatcctcgccgaaaatgcgctgcatctgccgcacttg
caggcgaaagacgaagtgacgatgttcaccgctgtgccttccgccgtcaccgaactgctt
cgccagcagagcattccggcatccgttcgcacggtgaacatgggcggcgagatggtgaaa
ggtccgctcgtgcaggaactgtaccaactgggacacatcgaaaaggtctacaacatgtac
ggcccgaccgaatccacggtgtactcgacgctggagctatgcgagcgcggcggttcccac
agtccgccgatcgggaagccgattcccggcactcgcgcctttgtgctcgatgaatttttg
cagcccgcgccaatcggtgtgcctggcgagctctttttgagcggcgcaggtcttgcccgc
ggctaccttgggcggccggaattgacggcggagcgttttctgcctcatccgttggcgcaa
ggggagcggatctaccgaactggcgaccgtgttcgccgattgccggacggacgattggaa
tacctcggccgcctcgaccatcaggtgaaagttcgcggctaccgcattgagaccggggag
atcgaagcggcgctgatgcagcacccggctgtgctggaagcggccgtgctggtgcgcgaa
gacgcgccgggcggtaagcagatcgtcggctatgtggtgttgcagactggcgaattcctg
accatgagcgacctgcgcgctgccataaaagtgcggctgcccgactatatggtgccgtcc
ctgctggtgacgctcgatgctctgccgctcacgccaaacggaaaagtcgacaaaaaggca
ttgcccgctcccgacttggcgcagatccgggagaccccgtatgtcgcgccgcgcaccgat
ctggaaagcaggctatgtgcgatctgggagcagctgctcggcgtggagcaggtcggggtc
cacgacaacttctttgacctgggcggccattcgctgctcgccacgcagctcgtttctcgc
gtgcgcgaggtatttgcggtcgaactggcgttgcgcgacctgtttgcagccagaacggtt
gaacagtttgccgccgttgtggaagcggccggccagaccgccaacgaaacgatgacgatc
gccaaatcggccaaccgtaaaacgcgcacgcgcagccgatag

DBGET integrated database retrieval system