KEGG   Tupaia chinensis (Chinese tree shrew): 102467720
Entry
102467720         CDS       T02978                                 

Gene name
WNT5B
Definition
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04360  Axon guidance
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102467720 (WNT5B)
   04390 Hippo signaling pathway
    102467720 (WNT5B)
   04150 mTOR signaling pathway
    102467720 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102467720 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102467720 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    102467720 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102467720 (WNT5B)
   05205 Proteoglycans in cancer
    102467720 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102467720 (WNT5B)
   05226 Gastric cancer
    102467720 (WNT5B)
   05217 Basal cell carcinoma
    102467720 (WNT5B)
   05224 Breast cancer
    102467720 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102467720 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    102467720 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102467720 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102467720 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102467720 (WNT5B)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102467720 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102467720
NCBI-ProteinID: XP_006163300
LinkDB
Position
Un
AA seq 358 aa
MPGLLLLFTAALLSGWAQLLTEANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVLQIGSRETAFTYAV
SAAGVVNAISRACREGELSTCGWRSARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARER
EKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKV
GDQLKEKYDSAAAMRVTRKGKLELVNSRFSQPTPEDLVYVDPSPDYCLRNETTGSLGTQG
RLCSKTSEGMDGCELMCCGRGYDQFKSVQVGRCHCRFHWCCFVKCKKCTEVVDQYVCK
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcccggcctgctgctgctgttcaccgccgcgctgctctctggctgggcccagctcctg
accgaggccaactcctggtggtcgctcgctctgaacccagtgcagagaccagagatgttc
atcattggggcacagccggtgtgcagccagctgccggggctctcccctggccagaggaag
ctgtgccagctgtaccaggagcacatggcctacatcggggaaggagccaagacgggcatc
agggagtgccagcaccagttccggcagaggcggtggaactgcagcaccgtggacaacacc
tcggtcttcgggcgagtcctgcagataggtagccgagagaccgccttcacctacgcggtg
agtgccgcgggggtggtcaacgccatcagccgggcttgccgcgagggcgagctctccacc
tgcggctggcggtcggcgcggcccaaggacctcccccgggactggctgtggggtggctgt
ggggacaacgtggagtatggctaccgctttgccaaggagttcgtggatgcccgggagcgg
gagaagaactttgccaagggatcggaggagcagggccgggtgctcatgaacctgcagaac
aacgaggccggccgaagggctgtgtacaagatggcagacgtcgcctgcaaatgccacggc
gtctcagggtcctgcagcctcaagacctgctggctccagctggccgagttccgcaaggtg
ggggaccagctgaaggagaagtacgacagtgccgccgccatgcgcgtcacccgcaagggc
aagctggagctggtcaacagccgcttcagccagcccaccccggaggacctggtctacgtg
gaccccagccccgactactgcctgcgcaacgagaccacgggctccctgggcacgcagggc
cgcctctgcagcaagacctcggagggcatggacggctgcgagctcatgtgctgcggccgc
ggctacgaccagttcaagagcgtgcaggtggggcgctgccactgccggttccactggtgc
tgcttcgtcaagtgcaagaagtgcaccgaggtcgtcgaccagtacgtctgcaaatag

KEGG   Tupaia chinensis (Chinese tree shrew): 102468229
Entry
102468229         CDS       T02978                                 

Gene name
WNT8B
Definition
(RefSeq) Wnt family member 8B
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102468229 (WNT8B)
   04390 Hippo signaling pathway
    102468229 (WNT8B)
   04150 mTOR signaling pathway
    102468229 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102468229 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102468229 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102468229 (WNT8B)
   05205 Proteoglycans in cancer
    102468229 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102468229 (WNT8B)
   05226 Gastric cancer
    102468229 (WNT8B)
   05217 Basal cell carcinoma
    102468229 (WNT8B)
   05224 Breast cancer
    102468229 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102468229 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    102468229 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102468229 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102468229 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102468229 (WNT8B)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102468229 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102468229
NCBI-ProteinID: XP_006157444
LinkDB
Position
Un
AA seq 408 aa
MSFSSYELYLQYCLQDLEEVSEQFPDDWSEGTRYTGTPAIYHTCYTGTWYTGTPATHHAR
YTGTPTTWTPPLDGTPATQVSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRW
NCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLG
GQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCH
GVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSIST
RELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRA
ETVSSCNCKFHWCCAVRCEQCRRGVTKYFCSRAERPRGGAAHKPARNP
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgagtttttcttcctatgagctgtatttgcagtactgcttacaagacttggaagaagtc
agtgaacaatttcctgatgactggtccgaaggtacccggtacacaggtacccccgctatc
tatcacacctgctacacaggtacctggtacacaggcacccctgctacacatcacgcccgc
tacacaggcacccccactacatggacacccccgctagatggcacccctgctacacaggtg
tcagtgaacaatttcctgatgactggtccgaaggcttacctgatctactccagcagcgtg
gcagccggtgcccagagtggtattgaagaatgcaaataccagtttgcctgggaccgttgg
aactgtcctgagagagccctgcagctgtccagccatggagggcttcgcagcgctaaccga
gagacagcgttcgtacacgccatcagttctgctggagtcatgtacactctgacgaggaac
tgcagcctcggggactttgacaactgtggctgcgatgactcccgtaacgggcagctgggg
ggccaaggctggctatggggaggctgcagtgacaacgtgggatttggagaggcaatttcc
aagcagtttgtcgatgccctggagacaggacaggatgcccgggcagccatgaacctgcac
aacaatgaggccggccgcaaggcggtcaagggcaccatgaaacgcacctgtaagtgccac
ggcgtgtctggcagctgcaccacgcagacctgctggctgcagctgcccgagttccgcgag
gtgggcgcgcacctgaaggagaagtaccacgcagcactcaaggtggacctcctgcagggt
gctggcaacagcgcggcgggccgcggcgccatcgccgacaccttccgctccatctccacc
cgggagctggtgcacctggaggactccccggattactgcctggagaacaaaacgctaggg
ctgctgggcacggaaggccgagagtgcctgcggcgcgggcgggccctgggccgctgggag
cgccgcagctgccgccggctctgcggggactgcgggctggcggtggaggagcgccgcgcc
gagaccgtgtccagctgcaactgcaagttccactggtgctgcgctgtccgctgcgagcag
tgccgccggggggtcaccaagtacttttgtagccgcgcagagcggccgcggggaggcgct
gcgcacaaacccgcgagaaatccctaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102479831
Entry
102479831         CDS       T02978                                 

Gene name
WNT2B
Definition
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102479831 (WNT2B)
   04390 Hippo signaling pathway
    102479831 (WNT2B)
   04150 mTOR signaling pathway
    102479831 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102479831 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102479831 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102479831 (WNT2B)
   05205 Proteoglycans in cancer
    102479831 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102479831 (WNT2B)
   05226 Gastric cancer
    102479831 (WNT2B)
   05217 Basal cell carcinoma
    102479831 (WNT2B)
   05224 Breast cancer
    102479831 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102479831 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    102479831 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102479831 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102479831 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102479831 (WNT2B)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102479831 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102479831
NCBI-ProteinID: XP_006149664
UniProt: L9KRZ6
LinkDB
Position
Un
AA seq 393 aa
MLKPGGAEEAAQLLPRRARAPTPASASRPVALDGSRTSVRLGLACLLLLLLLTLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctgaagccgggtggtgcggaggaagctgcgcagctcctccctcggcgcgcccgcgcc
ccaacgcccgcatccgcgtctagacccgtcgccctcgacggctcccggacttcggtccgc
ctaggtcttgcctgccttctgctgctgctgctactgacgctgcccgcccgcgtagacaca
tcctggtggtacatcggggcactgggggcccgagtgatctgtgacaatattcctggtttg
gtgagtcggcagcggcagctgtgccagcgctacccagacatcatgcgctcagtgggcgag
ggagcccgagaatggatccgagagtgtcagcaccagttccgccaccaccgctggaactgc
accaccctggaccgggaccacactgtctttggccgtgtcatgctcagaagcagtcgggag
gcagcatttgtgtatgccatctcatcagccggtgtggtccatgccatcactcgtgcatgt
agccagggtgaactcagtgtgtgcagctgtgacccctatacccgtggcagacaccatgac
caacgaggggactttgactggggtggctgcagtgacaacatccactatggcgtccgcttt
gccaaggcctttgtggatgctaaggagaagagactgaaagatgcccgggccctcatgaac
ttacataataaccgctgcggccgcacggctgtgcggcggtttctgaagctggagtgtaag
tgccatggtgtgagtggctcctgtactttacgcacctgctggcgtgcactctcagacttc
cgccgtacaggtgattacctgcggcgacgctacgatggggctgtgcaggtaacggccacc
caggatggtgccaatttcacagcagcccgccaaggctatcgccgtgccacccggactgat
cttgtctattttgacaactccccagactactgtgtcttggacaaggctgcaggttccctg
ggcactgcaggccgtgtctgcagcaagacatctaaaggaaccgatgggtgtgaaatcatg
tgctgtggccgagggtatgacacaacccgagtcacccgtgtcacccagtgtgagtgcaaa
ttccactggtgctgtgctgtgcggtgcaaggagtgcagaaacactgtggacgtccatacc
tgcaaggcccccaagaaggcagaatggctggaccagacctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102481567
Entry
102481567         CDS       T02978                                 

Gene name
WNT10B
Definition
(RefSeq) Wnt family member 10B
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102481567 (WNT10B)
   04390 Hippo signaling pathway
    102481567 (WNT10B)
   04150 mTOR signaling pathway
    102481567 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102481567 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102481567 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102481567 (WNT10B)
   05205 Proteoglycans in cancer
    102481567 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102481567 (WNT10B)
   05226 Gastric cancer
    102481567 (WNT10B)
   05217 Basal cell carcinoma
    102481567 (WNT10B)
   05224 Breast cancer
    102481567 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102481567 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    102481567 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102481567 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102481567 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102481567 (WNT10B)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102481567 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102481567
NCBI-ProteinID: XP_006168301
LinkDB
Position
Un
AA seq 440 aa
MLEEPRPRPPPSSLAGLLFLALCSRALSNEILGLKLPGGEPPLTANTVCLTLSGLSKRQR
GAKAGNKDPDGFEARSSPLLCAVGATGVAHLSRDHFDPSMPLIDEEAETLCLLFPSLSSD
FLPNHSTGTLAGLELEDGCAFLLPPQSQLPVSLTSTITPFSSPGFRESAFSFSMLAAGVM
HAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSASSPG
PQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKC
HGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELV
YFEKSPDFCERDPTVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVERCHCRFH
WCCYVLCDECKVTEWVNVCK
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgctggaggagccccggccgcggcctccgccctcgagcctcgcgggtctcctgttcctg
gcgctgtgcagtcgggctctgagcaatgagattttgggcctaaagctgcccggcggcgag
ccgccgctgacggccaacaccgtgtgcttgacgctgtccggcctgagcaagcggcagcgc
ggagccaaagctgggaacaaagaccctgatggctttgaagccaggagcagccccctcctc
tgtgctgtgggggccacaggtgttgctcacctgagcagagatcattttgacccatcaatg
cctcttatagatgaggaagccgagacgctgtgcttgctgttcccttccttgtccagtgac
tttctcccaaatcactcaactggtacattggcagggttggaattggaggatggttgtgca
ttccttctgcctcctcagtctcagctgcctgttagcctcacctccaccatcacacccttc
tcatccccaggtttccgtgagagtgctttttccttctccatgctggctgctggggtcatg
cacgcggtagccacggcctgcagtctgggcaagctggtgagctgcggctgtggctggaag
ggcagtggtgagcaggatcggctgagggccaagctgctgcagctgcaggcactgtcccgg
ggcaagagtttcccccactccctgcccagccctggccctggctcggcctccagtcctggc
ccccaggacacatgggaatggggtggctgtaaccatgacatggactttggagagaagttc
tctcgggatttcttggattccagggaagctcccagggacatccaggcacgaatgcgaatc
cacaacaacagggtggggcgccaggtggtaaccgaaaacttgaagcggaaatgcaagtgc
catggcacgtcaggcagttgccagttcaagacatgctggagggcagccccagaattccgg
gcagtgggggcagcattgagggagcggctgggccgggccatcttcatcgatacccacaac
cgcaattctggagccttccaacctcgcctgcgtccccgtcgcctctcaggagagctggtc
tactttgagaagtctcctgatttctgtgagcgtgaccctactgtgggctcccctggcaca
aggggccgggcctgcaacaagaccagccgcctattggatggctgtggcagcctgtgctgt
ggccgcgggcacaacgtgctccggcagacccgagttgagcgctgccattgccgcttccac
tggtgctgctatgtgctttgtgatgagtgcaaggtcacagagtgggtcaatgtgtgtaag
tga

KEGG   Tupaia chinensis (Chinese tree shrew): 102483253
Entry
102483253         CDS       T02978                                 

Gene name
WNT10A
Definition
(RefSeq) Wnt family member 10A
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102483253 (WNT10A)
   04390 Hippo signaling pathway
    102483253 (WNT10A)
   04150 mTOR signaling pathway
    102483253 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102483253 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102483253 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102483253 (WNT10A)
   05205 Proteoglycans in cancer
    102483253 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102483253 (WNT10A)
   05226 Gastric cancer
    102483253 (WNT10A)
   05217 Basal cell carcinoma
    102483253 (WNT10A)
   05224 Breast cancer
    102483253 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102483253 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    102483253 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102483253 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102483253 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102483253 (WNT10A)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102483253 (WNT10A)
SSDB
Motif
Pfam: wnt Ant_C Ebola_NP
Other DBs
NCBI-GeneID: 102483253
NCBI-ProteinID: XP_006168739
LinkDB
Position
Un
AA seq 336 aa
MGSAHPRPWLRLRPRPQPRPALWALLFFLLLLASAVPRSAPNDILDLHHPPEPVLTANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHSALPPATASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDI
HARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRAT
LIRPHNRNGGHLCRFHWCCFVVCEECRITEWVSVCK
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctccgaccccggccccagccgcggccc
gcgctctgggcgctcctgttcttcctgctgctgctggcttccgctgtgcccaggtcagca
cccaatgatatcctggacctccaccaccccccggagcctgtgctgacagccaacacagtg
tgcctgacactgccgggtctgagccggcggcagatggaggtgtgcgtgcgtcaccctgac
gtggccgcctctgccatccagggcatccagatcgccatccacgagtgccagcaccagttc
cgggatcagcgctggaactgctctagcctggagactcgcaacaagatcccctacgagagt
cccatcttcagcagaggtttccgagagagtgcttttgcctacgccattgcagcagcgggt
gtggtgcatgcagtttcaaatgcgtgtgccctgggcaaattgcgggcatgcggctgcgat
gcatctcgtcgtggggacgaggaggccttccgtcggaaactgcaccgcctgcagctggat
gcgctgcagcgcggaaagggcctgagccatggggtcccagaacactcagccttaccccct
gccactgccagcccaggcctgcaggactcctgggagtggggcggctgcagcccagacgtg
ggctttggggagcgcttctctaaagactttctggactccagggaacctcacagagacatc
catgcacgcatgcggctccacaacaaccgagtggggagacaggcggtgatggagaacatg
cggcggaagtgcaagtgccacggcacgtcaggcagttgccagctcaaaacgtgctggcag
gtgacaccggagttccgcgcagtgggggcgctgctgcgcagccgcttccaccgagccacg
ctcatccggccacacaaccgcaacggcggccacctgtgccgcttccactggtgctgcttc
gtggtgtgcgaggagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102483667
Entry
102483667         CDS       T02978                                 

Gene name
WNT6
Definition
(RefSeq) Wnt family member 6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102483667 (WNT6)
   04390 Hippo signaling pathway
    102483667 (WNT6)
   04150 mTOR signaling pathway
    102483667 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102483667 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102483667 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102483667 (WNT6)
   05205 Proteoglycans in cancer
    102483667 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102483667 (WNT6)
   05226 Gastric cancer
    102483667 (WNT6)
   05217 Basal cell carcinoma
    102483667 (WNT6)
   05224 Breast cancer
    102483667 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102483667 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    102483667 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102483667 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102483667 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102483667 (WNT6)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102483667 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102483667
NCBI-ProteinID: XP_006168740
LinkDB
Position
Un
AA seq 345 aa
LLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRE
CQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGXVTQACSMGELLQCGCQAPR
GLSPHSGLQGTPRPPGPAGSPDSSAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRA
LVQLHNNEAGRLAVRRYMRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRV
MGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGC
DLLCCGRGPRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL
NT seq 1038 nt   +upstreamnt  +downstreamnt
ctcctgtgtccggcgcacgtcggcggactgtggtgggcggtgggcagccccctggtcatg
gatcctaccagcatctgcaggaaggcaaggcggctggcggggcggcaggccgagttgtgc
caggctgagccggaagtggtggcagagctagcccggggtgcccgacttggggtgcgagag
tgccagttccagttccgcttccgccgctggaactgctccagtcacagcaaggcctttggg
cgcatcctgcagcaagatattcgggagactgccttcgtgtttgctattacggcggcgggc
nnggtcacgcaggcctgctccatgggcgagctgttgcagtgcggttgccaggcgccccgc
ggcctctccccgcactccggcttgcagggtactccccggcctcctggccccgcggggtcc
ccagacagcagtgccgcctgggaatggggaggctgtggtgacgacgtggacttcggggac
gagaagtcgaggctctttatggatgcgcagcacaagcgggggcgcggagacatccgcgcg
ctggtgcaactgcacaacaacgaggcgggccggctggcggtgaggagatacatgcgcacc
gagtgcaagtgccacggactgtcgggctcttgcgccctacgcacctgctggcagaagcta
cccccgttccgcgaggtgggcgcgcggctcctggagcgcttccacggcgcctcacgcgtc
atgggcaccaatgacggcaaggccctgctgcccgcggtccgcacgctcaagccgcccggc
cgcgccgacctcctctacgccgccgactcgcccgatttctgcgccccgaaccggcgcaca
ggctctccgggcacgcgcggccgcgcctgcaacagcagtgccccggacctcagcggctgc
gacctgttgtgctgcggacggggcccccgccaggagagcgtgcagctcgaggagaactgc
ctgtgccgcttccactggtgctgcgtggtgcaatgtcaccgctgccgcgtgcgcaaggag
ctcagcctctgcctctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102483867
Entry
102483867         CDS       T02978                                 

Gene name
WNT2
Definition
(RefSeq) Wnt family member 2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102483867 (WNT2)
   04390 Hippo signaling pathway
    102483867 (WNT2)
   04150 mTOR signaling pathway
    102483867 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102483867 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102483867 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102483867 (WNT2)
   05205 Proteoglycans in cancer
    102483867 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102483867 (WNT2)
   05226 Gastric cancer
    102483867 (WNT2)
   05217 Basal cell carcinoma
    102483867 (WNT2)
   05224 Breast cancer
    102483867 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102483867 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    102483867 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102483867 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102483867 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102483867 (WNT2)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102483867 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102483867
NCBI-ProteinID: XP_006162432
LinkDB
Position
Un
AA seq 360 aa
MNACLGGIWPWLPLLLTWLTPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSRITRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWATPA
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcctgtctcggtggaatctggccctggctccctctgctcttgacctggctcacc
cctgaggtcagctcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccgtcagaggcagctctgccacagacacccagat
gtgatgcgtgccattggcctgggcgtagccgagtggaccgcagagtgccagcaccaattc
cgccagcaccgctggaactgcaacaccctggacagggatcacagcctctttggcagggtc
ctactccgcagtagtcgggaatctgcctttgtttacgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgcgatccaaag
aagaagggaaccgccaaggacagcaagggcacctttgattggggtggctgtagtgataac
attgactatgggatcaaatttgcccgagcatttgtggatgccaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcataacaacagagccggcaggaaggctgtaaagcgg
ttcttgaaacaagaatgcaagtgtcatggtgtgagtggctcatgtactctgaggacatgc
tggctggccatggctgacttcagaaaaacgggtgattatctctggaggaagtacaatggg
gccatccaggtggtcatgaatcaggacggcactggtttcactgtggctaacaagaggttt
aagaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacctgacttcccgaggc
atggacagctgtgaagtcatgtgctgtgggagaggctacgacacctcccgcatcacaagg
atgaccaagtgtgagtgtaagttccactggtgctgtgctgtgcgctgtcaggactgcctg
gaggccctagatgtgcacacatgcaaggcccccaagagtgccgactgggcaacccccgca
tga

KEGG   Tupaia chinensis (Chinese tree shrew): 102484353
Entry
102484353         CDS       T02978                                 

Gene name
WNT7A
Definition
(RefSeq) Wnt family member 7A
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102484353 (WNT7A)
   04390 Hippo signaling pathway
    102484353 (WNT7A)
   04150 mTOR signaling pathway
    102484353 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102484353 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102484353 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102484353 (WNT7A)
   05205 Proteoglycans in cancer
    102484353 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102484353 (WNT7A)
   05226 Gastric cancer
    102484353 (WNT7A)
   05217 Basal cell carcinoma
    102484353 (WNT7A)
   05224 Breast cancer
    102484353 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102484353 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    102484353 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102484353 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102484353 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102484353 (WNT7A)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102484353 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 102484353
NCBI-ProteinID: XP_006155476
LinkDB
Position
Un
AA seq 282 aa
MGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGN
LSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEA
GRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNK
RPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLM
CCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 849 nt   +upstreamnt  +downstreamnt
atgggcctggacgagtgtcagtttcaattccgcaatggccgctggaactgctcggcgctg
ggggagcgcacagtcttcggaaaggagctcaaagtggggagtcgggaagcagccttcaca
tatgccattattgctgctggcgtggcccatgccatcacagctgcctgcacccagggcaac
ctgagcgactgtggctgcgacaaggagaagcaaggccagtaccaccgggacgagggctgg
aagtggggtggctgctctgccgacatccgctacggcatcggcttcgccaaggtctttgtg
gatgcccgggagatcaagcagaatgcccggactctcatgaacttacacaataacgaggca
ggccgaaagatcctggaggagaacatgaagctggagtgcaaatgccacggcgtgtccggc
tcatgcaccaccaagacgtgctggaccacactgccacagtttcgggagctgggctacgtg
ctcaaggacaagtacaatgaggcggtgcacgtggagccagtgcgtgccagccgtaacaag
cggcccacgttcctgaagatcaagaagcccctgtcctaccgcaagcccatggatacagac
ctggtgtacattgagaagtcacccaactactgtgaggaggacccagttacaggcagcgtg
ggtacgcaaggccgtgcctgcaacaagacagccccccaggccagcggctgcgacctcatg
tgctgcgggcgtggctacaacacccaccagtatgcccgcgtgtggcagtgcaactgtaag
ttccactggtgctgctacgtcaagtgcaacacgtgcagcgagcgcaccgagatgtacaca
tgcaagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102489001
Entry
102489001         CDS       T02978                                 

Gene name
WNT3
Definition
(RefSeq) Wnt family member 3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102489001 (WNT3)
   04390 Hippo signaling pathway
    102489001 (WNT3)
   04150 mTOR signaling pathway
    102489001 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102489001 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102489001 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102489001 (WNT3)
   05206 MicroRNAs in cancer
    102489001 (WNT3)
   05205 Proteoglycans in cancer
    102489001 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102489001 (WNT3)
   05226 Gastric cancer
    102489001 (WNT3)
   05217 Basal cell carcinoma
    102489001 (WNT3)
   05224 Breast cancer
    102489001 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102489001 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    102489001 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102489001 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102489001 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102489001 (WNT3)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102489001 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102489001
NCBI-ProteinID: XP_006159186
LinkDB
Position
Un
AA seq 338 aa
MVPLPSVCCRSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGI
QECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTST
ICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTT
ILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVE
TLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGR
GRNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggtgccactgccctctgtctgctgcaggtccctggccctgggccagcagtacacatct
ctgggctcacagcctctactctgcggctccatcccaggcctggtccccaaacaactgcgc
ttctgccgaaattacatcgagatcatgcccagcgtggccgagggtgtgaagctgggcatc
caagagtgtcagcaccagttccggggccgccgctggaactgcaccaccatagatgacagc
ctggccatcttcgggcccgtcttagacaaagccacccgcgagtcggccttcgtacacgcc
atcgcttctgcaggtgtggccttcgccgtcacccgctcctgcgctgagggcacctccacc
atctgcggctgtgactcgcatcataaggggccaccaggagaaggctggaagtggggcggc
tgcagcgaggacgctgacttcggggtgctggtatcccgggagttcgcggatgctcgcgag
aacaggccagatgcacgctcagccatgaacaagcacaacaacgaggcgggccgcacgacc
atcctggaccacatgcacctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtg
aagacctgctggtgggctcagcctgacttccgtgccattggcgacttcctcaaggacaag
tatgacagtgcctcggagatggtggtggagaagcaccgtgagtcccggggctgggtggag
acgctccgagccaagtacgcgctcttcaaaccacccaccgagagggacctggtctactac
gagaactcgcccaacttttgtgagcccaacccggagacgggctcctttggcaccagggac
cggacttgcaatgtcacctcccatggcatcgatggctgcgatctgctctgctgtggccgt
ggccgcaacacgaggacggagaagcggaaggagaagtgccactgcatcttccactggtgc
tgctacgtcagctgccaggagtgcatccgcatctacgacgtgcacacctgcaagtag

KEGG   Tupaia chinensis (Chinese tree shrew): 102489417
Entry
102489417         CDS       T02978                                 

Gene name
WNT9B
Definition
(RefSeq) Wnt family member 9B
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102489417 (WNT9B)
   04390 Hippo signaling pathway
    102489417 (WNT9B)
   04150 mTOR signaling pathway
    102489417 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102489417 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102489417 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102489417 (WNT9B)
   05205 Proteoglycans in cancer
    102489417 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102489417 (WNT9B)
   05226 Gastric cancer
    102489417 (WNT9B)
   05217 Basal cell carcinoma
    102489417 (WNT9B)
   05224 Breast cancer
    102489417 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102489417 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    102489417 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102489417 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102489417 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102489417 (WNT9B)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102489417 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102489417
NCBI-ProteinID: XP_006159187
LinkDB
Position
Un
AA seq 355 aa
MRPPPALALAALCLLALPAAAAAAYFGLTGRDVLTPFPGVGTASAPVEGGAHLKQCDLLK
LSRRQKQLCRRXGAGLRDAAHLGLLECQFQFRHERWNCSLEGRTGLLKRGFKETAFLYAV
SSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSHFLGPKRG
SKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRY
DSALKVSSATNEALGRLELWAPTKPGSPAKGLVPRPGDLVYMEDSPSFCRPSKYSPGTAG
RVCPWGPSGSSLCCGRGYDTQSRMVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgcgctctgcctgctggcgctgcccgcagcc
gccgccgccgcctacttcggtctgaccgggcgtgacgtcctgacacccttcccaggagtg
ggtactgcatcagccccagtggagggtggggcccacctgaagcagtgtgatctgctgaag
ttgtcccggcggcagaagcagctgtgtcggcggnngggggcaggcctgcgggatgctgcg
caccttggcctgctcgagtgccagttccagttccggcatgagcgctggaactgcagcctg
gagggcaggactggcctgctcaagagaggtttcaaggagacggccttcctgtacgcagtg
tcctcagccgccctcacccacacactggcccgggcctgcagtgctgggcgcatggagcgg
tgcacctgtgacgactctccgggcctggagagccggcaggcctggcagtggggtgtgtgt
ggcgacaacctcaagtacagcaccaagttcctgagccacttcctgggacccaagagagga
agcaaggacctgcgggcacgggcagatgcccacaacacccatgtgggcatcaaggctgtg
aagagtggcctcaggaccacgtgtaagtgccatggcgtgtcaggctcctgtgccgtgcgc
acctgctggaagcagctctccccattccgtgagacaggtcaggtgctgaagctgcgctat
gactcggctctcaaggtatccagtgccaccaacgaggccttgggccgcctggagctgtgg
gcacccaccaagccgggcagccctgccaagggccttgtgccccggccaggggacctcgtc
tacatggaggactcgcccagcttctgccgccccagcaagtactcacccggcacggcgggc
agagtgtgcccgtgggggcccagtggcagcagcctgtgctgcgggcggggctacgacacc
cagagtcgcatggtggccttctcctgccactgccaggtgcagtggtgctgctacgtggag
tgccagcagtgcgtgcaggaggagcttgtgtacacctgcaagcactag

KEGG   Tupaia chinensis (Chinese tree shrew): 102489573
Entry
102489573         CDS       T02978                                 

Gene name
WNT5A
Definition
(RefSeq) Wnt family member 5A
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04360  Axon guidance
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102489573 (WNT5A)
   04390 Hippo signaling pathway
    102489573 (WNT5A)
   04150 mTOR signaling pathway
    102489573 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102489573 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102489573 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    102489573 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102489573 (WNT5A)
   05205 Proteoglycans in cancer
    102489573 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102489573 (WNT5A)
   05226 Gastric cancer
    102489573 (WNT5A)
   05217 Basal cell carcinoma
    102489573 (WNT5A)
   05224 Breast cancer
    102489573 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102489573 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    102489573 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102489573 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102489573 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102489573 (WNT5A)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102489573 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102489573
NCBI-ProteinID: XP_014441264
LinkDB
Position
Un
AA seq 333 aa
MKKSIGILSPGVALGTARRAMSSKFFLMALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSHLMVTLWGCLTLQNLACASLRGRTIAPPDPCPPWGSSMICTLTVPISL
QTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQV
NSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQF
KTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaagaagtcgattggaatattaagcccaggagttgctttggggacggctcgacgtgca
atgtcttccaagttctttctaatggctttggccatatttttctccttcgcccaggttgta
atagaagccaattcttggtggtcgttaggtatgaataaccctgttcagatgtcagaagtg
tatattatcggagcgcagcccctctgcagccaactcgcaggactttctcaaggacagaag
aaactgtgccacttatatcaggaccacatgcagtacatcggagaaggggcgaagacgggc
atcaaagagtgccagtatcaattccgacaccgacggtggaactgcagcaccgtggataac
acctccgttttcggcagggttatgcagataggcagccatttgatggtaaccctttggggg
tgtctgactctgcagaacttggcctgtgctagcctgaggggtcgcaccatcgccccccca
gacccatgcccgccttggggctcctccatgatctgcacactcactgtccccatttccctg
cagaccgtgtacaacttggccgacgtggcctgtaagtgccacggggtgtcgggctcctgt
agcctcaagacgtgctggctgcagctggcggacttccgcaaggtgggcgatgccctgaag
gagaagtatgacagtgcggcggccatgcggctcaacagccggggcaaactggtgcaggtc
aacagccgcttcaactcgcccaccacgcaggacctggtctacatcgaccccagccccgac
tactgcgtgcgcaacgagagcacaggatccctgggcacgcagggccgcctgtgcaacaag
acgtcggagggcatggacggctgtgagctcatgtgctgcggccgcggctacgaccagttc
aagacggtgcagaccgagcgctgccactgcaagttccactggtgctgctacgtcaagtgc
aaaaagtgcacggagatcgtggaccagtttgtgtgcaaatag

KEGG   Tupaia chinensis (Chinese tree shrew): 102490209
Entry
102490209         CDS       T02978                                 

Gene name
WNT8A
Definition
(RefSeq) Wnt family member 8A
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102490209 (WNT8A)
   04390 Hippo signaling pathway
    102490209 (WNT8A)
   04150 mTOR signaling pathway
    102490209 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102490209 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102490209 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102490209 (WNT8A)
   05205 Proteoglycans in cancer
    102490209 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102490209 (WNT8A)
   05226 Gastric cancer
    102490209 (WNT8A)
   05217 Basal cell carcinoma
    102490209 (WNT8A)
   05224 Breast cancer
    102490209 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102490209 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    102490209 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102490209 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102490209 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102490209 (WNT8A)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102490209 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102490209
NCBI-ProteinID: XP_006169945
LinkDB
Position
Un
AA seq 352 aa
MGDLFMFGMAVGIFCATFSVSAWSVNNFLVTGPKAYLTYTTSVALGAQSGIEECKFQFTW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFDNCGCDESKNG
KTGGHGWIWGGCSDNVEFGEKISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKKTC
KCHGISGSCSIQTCWLQLADFREMGDYLKAKYDRAVKIEMDKQWLRTGNSAEGHGAPTEA
FLPSAEAELIFLEESPDYCTRNSSMGIYGTEGRECLQNSHNTSRREQRSCRHLCTECGLQ
VEERRTEATSSCNCKFQWCCTVKCDQCKHVVNKYYCTHSPGGVQSRGKGSPR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggggacctgtttatgtttgggatggctgtgggcatattctgtgccaccttcagtgtc
tctgcctggtcagtgaacaatttcctggtaacaggccccaaggcctatctaacctacact
accagcgtggccttgggtgcccagagtggcattgaggagtgtaagttccaattcacttgg
gaacgctggaactgccctgaaaatgctctccagctctccacccacaacaggctgagaagc
gccaccagagagacttccttcattcacgctatcagctctgcaggagtcatgtataccatc
accaagaattgtagcatgggtgacttcgacaactgtggctgtgatgaatccaaaaatgga
aaaactggaggccatggctggatctggggaggctgcagcgacaatgtggaatttggggaa
aagatctctaaactctttgtggacagtttggagaaggggaaggatgccagagccctgatg
aatcttcacaacaacagggccggcaggctggcagtgagagccaccatgaaaaagacatgc
aaatgtcacggcatctcaggaagctgcagtattcagacatgctggctgcagctggctgat
ttccgggagatgggagattacttgaaggccaagtacgaccgggcagtgaaaattgagatg
gataaacagtggctgaggactgggaacagcgctgagggccacggggcgcccacggaggcc
ttccttcctagcgcagaggctgagctgatttttctagaggaatcaccagattattgtacc
cgcaattccagcatgggcatctatggtacagagggtcgtgagtgcctgcagaacagccac
aacacatccaggagggagcaacgcagctgcaggcacctttgcactgagtgtgggctgcag
gtggaagagaggagaactgaggccacaagcagctgtaactgcaaattccagtggtgctgt
acggtcaagtgtgaccagtgtaagcatgtggtgaacaagtactactgcacacactcccca
ggtggtgtccagtcccggggaaagggcagcccgcgctaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102493340
Entry
102493340         CDS       T02978                                 

Gene name
WNT4
Definition
(RefSeq) Wnt family member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04360  Axon guidance
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04919  Thyroid hormone signaling pathway
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102493340 (WNT4)
   04390 Hippo signaling pathway
    102493340 (WNT4)
   04150 mTOR signaling pathway
    102493340 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102493340 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102493340 (WNT4)
   04916 Melanogenesis
    102493340 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    102493340 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102493340 (WNT4)
   05205 Proteoglycans in cancer
    102493340 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102493340 (WNT4)
   05226 Gastric cancer
    102493340 (WNT4)
   05217 Basal cell carcinoma
    102493340 (WNT4)
   05224 Breast cancer
    102493340 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102493340 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    102493340 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102493340 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102493340 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102493340 (WNT4)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102493340 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102493340
NCBI-ProteinID: XP_014441995
LinkDB
Position
Un
AA seq 305 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAI
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRER
SKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALK
EKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRT
CNKTSKAIDGCELLCCGRGFPPGQGGVELAERCSCKFHWCCFVKCRQCQRLFEPHTRRGT
LHTCR
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtgcaagaggaacctggaggtgatggactcggtgcgccgcggcgcccagctggccatc
gaggagtgccagtaccagttccggaaccggcgctggaactgctccacactcgactccctg
cccgtgtttggcaaggtggtgacgcaagggactcgggaggcggccttcgtgtacgccatc
tcttcggcaggtgtggccttcgcagtgactcgagcatgcagcagcggggagctggaaaag
tgtggatgtgaccggacggtgcatggggtcagcccacagggattccagtggtcaggctgc
tcggacaacatcgcctacggcgtggccttctcacagtcctttgtggatgtgcgagagaga
agcaagggggcctcatctagccgggccctcatgaacctccacaacaacgaggccggcagg
aaggctatcctgacacacatgcgggtggagtgcaagtgccacggggtgtcaggatcctgt
gaggtaaagacgtgctggcgagccgtgccgcccttccgccaggtgggccacgcactgaag
gagaagttcgacggcgccaccgaggtcgagccacgccgcgtgggctcctccagggcgctg
gtgccacgcaatgctcagttcaagccacatacagacgaggacctggtgtacctggagccc
agcccagacttctgcgaacaggacatgcgcagcggcgtgctgggcacgcggggacgcacg
tgcaacaagacatccaaggccattgacggctgcgagctgctctgctgcggccgcggcttt
ccccccggccaggggggggtggagttggccgagcgctgcagctgcaagttccactggtgc
tgcttcgtcaagtgccggcagtgccagcggctttttgagccgcacacgcgccggggcaca
ctgcacacgtgccggtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102494826
Entry
102494826         CDS       T02978                                 

Gene name
WNT11
Definition
(RefSeq) Wnt family member 11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102494826 (WNT11)
   04390 Hippo signaling pathway
    102494826 (WNT11)
   04150 mTOR signaling pathway
    102494826 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102494826 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102494826 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102494826 (WNT11)
   05205 Proteoglycans in cancer
    102494826 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102494826 (WNT11)
   05226 Gastric cancer
    102494826 (WNT11)
   05217 Basal cell carcinoma
    102494826 (WNT11)
   05224 Breast cancer
    102494826 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102494826 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    102494826 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102494826 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102494826 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102494826 (WNT11)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102494826 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102494826
NCBI-ProteinID: XP_006141072
LinkDB
Position
Un
AA seq 354 aa
MRARPQVCAALLFALVLQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVHAAREVTKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AIGHSIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEVKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgcggcgctgctcttcgccctggtgctgcagactggc
gtgtgctatggcatcaaatggctggccctgtccaagaccccggcggccctggcactgaac
cagacgcagcactgcaagcagctggagggcctggtgtcggcgcaggtgcagctgtgccgc
agcaatctggagctcatgcacaccattgtgcacgccgcccgcgaggtcaccaaggcctgc
cgcagggccttcgctgacatgcgctggaactgctcctccatcgagctcgcccccaactac
ctgctcgacctggagagagggacccgggagtcggccttcgtgtatgcgctgtcggccgcc
gccatcggccactctatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgtgcctctctggaggtgaagtgtaaatgccacggagtgtccggctcctgctctatc
cgcacttgctggaaggggctgcaggagctgcgggacgtggctgccgacctcaagacacgc
tacctgtcggccaccaaggttgttcatcggcccatgggcacccgcaagcacctggtgccc
aaggacctggacatccggcccgtgaaggactcagagctggtctatctgcagagctctccc
gacttctgcatgaagaacgagaaggtgggctcccacggcacacaggacaggcagtgcaac
aagacgtccaatggcagtgacagctgcgacctcatgtgctgcgggcgcggctacaacccc
tacacggaccgcgtggtcgagcggtgccactgcaagtaccactggtgctgctacgtcacc
tgccgccggtgcgagcgcaccgtggagcgctacgtctgcaagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102496226
Entry
102496226         CDS       T02978                                 

Gene name
WNT9A
Definition
(RefSeq) Wnt family member 9A
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102496226 (WNT9A)
   04390 Hippo signaling pathway
    102496226 (WNT9A)
   04150 mTOR signaling pathway
    102496226 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102496226 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102496226 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102496226 (WNT9A)
   05205 Proteoglycans in cancer
    102496226 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102496226 (WNT9A)
   05226 Gastric cancer
    102496226 (WNT9A)
   05217 Basal cell carcinoma
    102496226 (WNT9A)
   05224 Breast cancer
    102496226 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102496226 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    102496226 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102496226 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102496226 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102496226 (WNT9A)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102496226 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 102496226
NCBI-ProteinID: XP_006147083
LinkDB
Position
Un
AA seq 343 aa
MVLEQLNIDRLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETL
VEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACS
AGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLV
GVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEATG
EAGAIPPPRGRASGMGGSDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESI
CCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggttctggagcaactgaacatcgacaggctgacaggcagcgagcccttgaccatcctc
ccactgaccctggagccagaggcggctgcccaggcacactacaaggcctgcgatcggttg
aagctggagcgtaagcagcggcgcatgtgccgccgggacccaggcgtggccgagacactg
gtggaggcagtcagcatgagtgcgcttgagtgccagtatcagttccgctttgagcgctgg
aactgcactttggagggccgctaccgggccagcctgctcaagcgaggattcaaggagacg
gccttcctctacgccatctcctcagctggcctgacacatgcactggccaaggcatgcagc
gcgggacgcatggaacgctgcacgtgtgacgaggcacccgacctggagaaccgtgaggcc
tggcagtggggcggctgtggggacaacctcaagtatagcagcaagtttgtcaaggagttc
ctgggcaggcggtcaagcaaggatctgcgagcccgcgtggacttccacaacaacctcgtg
ggtgtgaaggtgatcaaggctggagtagagaccacctgcaagtgccacggcgtgtcaggc
tcatgcacagtgcggacctgctggcgacagctggcacccttccatgaggtgggcaaacac
ctgaaacacaagtatgaaacagcgcttaaggtgggcagcaccaccaacgaagccactggt
gaggcaggagccatccccccgccacggggccgggcttcagggatgggtggcagtgacccg
ctaccacgcacaccagaacttgtgcacctagatgactctcccagtttctgcttggctggc
cgcttctctccaggcaccgctggccgcagatgccaccgtgagaagaactgtgagagtatc
tgctgtggccgtggccacaacacacagagccgtgtggtgacaaggccctgccagtgccag
gtgcgctggtgctgctatgtggagtgcaggcagtgcacacaacgtgaggaggtctacacc
tgcaagggctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102497530
Entry
102497530         CDS       T02978                                 

Gene name
WNT16
Definition
(RefSeq) Wnt family member 16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102497530 (WNT16)
   04390 Hippo signaling pathway
    102497530 (WNT16)
   04150 mTOR signaling pathway
    102497530 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102497530 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102497530 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102497530 (WNT16)
   05202 Transcriptional misregulation in cancer
    102497530 (WNT16)
   05205 Proteoglycans in cancer
    102497530 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102497530 (WNT16)
   05226 Gastric cancer
    102497530 (WNT16)
   05217 Basal cell carcinoma
    102497530 (WNT16)
   05224 Breast cancer
    102497530 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102497530 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    102497530 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102497530 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102497530 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102497530 (WNT16)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102497530 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102497530
NCBI-ProteinID: XP_014443543
LinkDB
Position
Un
AA seq 366 aa
MDRAALLGLPRLCALWAALLALFPCGAHGNWMGAAIASFGVPEKLGCTSLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCMVATAAATAAAPLGTGPLFGYELNSGTK
ETAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTSLQNGGSASEGWHWGGCSDDVQYGMXS
RKFLDFPIRNSTGKESKILLAMKLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTM
SSFEKIGNLLKDKYENSIQISDKVKRKMRRREKDQRKIPIRKDDLLYVNKSPNYCVEDKK
LGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCKRCESMT
DVHTCK
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggacagagcggcgctcctgggactgccccgcctgtgcgcgctgtgggcagccctgctc
gcgctgttcccctgcggagcccacggaaactggatgggggcggccatcgcctccttcggg
gttccggagaagctgggctgcaccagcttgcctctgaacagccgccagaaggagctgtgc
aagcggaagccgtacctgctgcccagcatccgcgagggcgcccggctgggcattcaggag
tgcaggagccagttcaggcacgagaggtggaactgcatggtcgccaccgccgccgccacc
gccgcggctccgctcggcaccggccccctctttggctacgagctgaacagcggcaccaag
gagacagcatttatttatgctgtgatggcggcaggcctggtgcattctgtgaccaggtca
tgcagcgcaggcaacatgacagagtgttcctgtgacacctctttgcagaatggcggctca
gcaagtgaaggctggcactgggggggctgctccgatgatgtccagtatggcatgnncagc
aggaaattcctagatttccccattagaaattccacgggaaaagaaagcaaaatattgtta
gcaatgaagctacataacaatgaagccggaagacaggctgtcgccaagttgatgtcagta
gactgtcgctgccatggagtttctggctcctgtgctgtgaaaacatgctggaaaactatg
tcttcttttgaaaagatcggcaatttgttgaaggataaatacgaaaacagtatccagata
tcagacaaagtaaagaggaaaatgcgcagaagagaaaaagatcagaggaaaataccaatc
cgcaaggatgatctgctctacgtgaataaatctcccaattactgtgtagaggataagaaa
ctggggatcccagggacccaaggcagagaatgcaaccggacatcagaaggtgctgatggc
tgcaacctcctctgctgtggccggggctacaacacccatgtggtcaggcacgtggagagg
tgtgagtgcaaattcatctggtgctgctacgtgcgctgcaagaggtgtgaaagcatgact
gatgtgcacacttgcaagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102499190
Entry
102499190         CDS       T02978                                 

Gene name
WNT1
Definition
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102499190 (WNT1)
   04390 Hippo signaling pathway
    102499190 (WNT1)
   04150 mTOR signaling pathway
    102499190 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102499190 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102499190 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102499190 (WNT1)
   05205 Proteoglycans in cancer
    102499190 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102499190 (WNT1)
   05226 Gastric cancer
    102499190 (WNT1)
   05217 Basal cell carcinoma
    102499190 (WNT1)
   05224 Breast cancer
    102499190 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102499190 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    102499190 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102499190 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102499190 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102499190 (WNT1)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102499190 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102499190
NCBI-ProteinID: XP_006168276
UniProt: L8Y7C5
LinkDB
Position
Un
AA seq 370 aa
MGLWALLPGWVSAALLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgctgcccggctgggtttctgctgcgctactgctagcgctggcc
gctctacccgcagccttggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcgtcctccacgaacctgctgaccgactccaagagtctgcagctagtgctcgagcccagt
ctgcaactactgagccgcaaacagcggcggctgatccgccagaacccggggatcctgcac
agtgtgagcggtggtctgcagagcgcggtgcgcgagtgcaagtggcagttccggaaccgc
cgctggaactgccccactgctccggggccccacctcttcggcaagatcgtcaaccgaggc
tgccgggaaacagcgtttatctttgccatcacctccgccggggtcacccattccgtggcg
cgctcctgctctgagggctccatcgagtcctgcacgtgcgactaccggcggcgcggtcct
gggggtcctgattggcactggggagggtgcagcgacaacatcgacttcggccgcctcttc
gggcgagagttcgtggactccggggagaaagggcgggacctgcgctttctcatgaacctc
cacaacaacgaggcgggccgcacgaccgtgttctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcctgcaccgtgcgcacgtgctggatgcggctgcccacgctgcgc
gcggtgggcgacgtgctgcgcgaccgctttgacggcgcctctcgagtcctctacggcaac
cgcggcagcaaccgcgcttcgcgggccgagctgctgcgccttgagccggaagacccagcg
cacaagccgccttccccccacgacctcgtctacttcgagaaatcgcccaatttctgcaca
tacagcggacgcctggggacggcgggcactgcagggcgcgcctgcaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgtggccggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccatgtcagctgccgcaactgc
acgcacacgcgcgtattgcacgagtgtctgtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102500004
Entry
102500004         CDS       T02978                                 

Gene name
WNT7B
Definition
(RefSeq) Wnt family member 7B
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102500004 (WNT7B)
   04390 Hippo signaling pathway
    102500004 (WNT7B)
   04150 mTOR signaling pathway
    102500004 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102500004 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102500004 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102500004 (WNT7B)
   05205 Proteoglycans in cancer
    102500004 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102500004 (WNT7B)
   05226 Gastric cancer
    102500004 (WNT7B)
   05217 Basal cell carcinoma
    102500004 (WNT7B)
   05224 Breast cancer
    102500004 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102500004 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    102500004 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102500004 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102500004 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102500004 (WNT7B)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102500004 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102500004
NCBI-ProteinID: XP_006164694
LinkDB
Position
Un
AA seq 349 aa
MHRNFRKWIFYVSLCFGVLYVKLGALSWVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGIDECQHQFRFGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAAT
AACSQGKLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM
NLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEV
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG
ADGCDTMCCGRGYNTHQYTTVGQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcacagaaactttcgcaagtggattttctacgtgtctctctgcttcggcgtcctctac
gtgaagctcggagcactgtcatgggtggtggccttgggcgccaacatcatctgcaacaag
atccctggcctggccccgcggcagcgcgccatctgccagagccggcccgatgccatcatc
gtgatcggggagggcgcgcagatgggcatcgatgagtgccagcaccagttccgcttcggg
cgctggaactgctcggccctcggtgagcggaccgtcttcgggcaggagctccgagtaggg
agccgggaggccgccttcacttacgccatcaccgcggccggtgtggcccacgcggccacg
gccgcctgcagccagggcaaactgagcaactgtggctgcgaccgcgagaagcagggctac
tacaaccaggccgagggctggaagtggggcggctgctctgctgacgtgcgctatggcatc
gacttctctcggcgcttcgtggatgcccgcgagatcaagaagaacgcgcggcgcctcatg
aacctgcacaacaatgaggccggcaggaaggtgctggaggaccgcatgaagctggagtgc
aagtgccacggtgtgtcaggctcctgcaccaccaagacctgctggaccacgctgcctaag
ttccgcgaggtgggccacctgctcaaggagaagtacaacgccgcggtgcaggtggaggtg
gtgcgcgccagccgcctgcgccagcccaccttcctgcgcatcaagcagctgcgcagctac
cagaagcccatggagacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacgcggccacgggcagcgtgggcacgcagggccgcctgtgcaaccgcacctcgcccggc
gccgacggctgcgacaccatgtgctgcggccgcggctacaacacccaccagtacaccacg
gtcgggcagtgcaactgcaagttccactggtgctgcttcgtcaagtgcaacacctgcagc
gagcgcaccgaggtcttcacctgcaagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102501628
Entry
102501628         CDS       T02978                                 

Gene name
WNT3A
Definition
(RefSeq) Wnt family member 3A
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102501628 (WNT3A)
   04390 Hippo signaling pathway
    102501628 (WNT3A)
   04150 mTOR signaling pathway
    102501628 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102501628 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102501628 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102501628 (WNT3A)
   05206 MicroRNAs in cancer
    102501628 (WNT3A)
   05205 Proteoglycans in cancer
    102501628 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102501628 (WNT3A)
   05226 Gastric cancer
    102501628 (WNT3A)
   05217 Basal cell carcinoma
    102501628 (WNT3A)
   05224 Breast cancer
    102501628 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102501628 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    102501628 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102501628 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102501628 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102501628 (WNT3A)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102501628 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102501628
NCBI-ProteinID: XP_006147032
UniProt: L9L1S7
LinkDB
Position
Un
AA seq 352 aa
MAPLGYFLFLCSLKQAVGSYPIWWSLAVGPQYSSLGTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGVKIGIRECQHQFRGRRWNCTTVNNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSATICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECARVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccccactcggatacttcttattcctctgcagcctgaagcaggcggtgggcagctac
ccaatctggtggtccctggctgttggtcctcaatactcctctttgggcacccagcccatc
ctgtgtgccagcatcccagggctggtacccaaacagctgcgcttctgcaggaactatgtc
gagatcatgcccagcgtggccgagggtgtcaaaattggcatccgggaatgccagcaccag
ttccgaggccgtcggtggaactgcaccactgtcaacaacagcctggccatctttggccct
gtgctcgacaaagccaccagggagtcagcttttgtccatgctattgcctcagctggtgtg
gcctttgcagtgacacgctcatgtgcggagggctcagccaccatctgtggctgtagtagc
cgtcatcagggctcaccaggtgaaggttggaagtggggcggctgtagtgaggacatcgag
tttggaggcatggtgtctcgggagtttgcagatgcccgggagaacaggcctgatgcccgc
tctgctatgaaccgtcacaacaacgaggctgggcgccaggccattgccagccacatgcat
ctcaagtgtaagtgccacgggttgtcaggcagctgcgaggtgaagacctgctggtggtcg
cagcccgacttccgcgccatcggcgacttcctcaaggacaagtacgacagcgcctcagag
atggtggtcgagaaacaccgagagtcgcgcggctgggtggagaccctgcggccacgctac
acctacttcaaggtgcccacagagcgcgacctggtctactacgaagcctcgcccaacttc
tgcgagcccaacccggagacaggctccttcggcacgcgcgaccgcacctgcaacgtgagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccggggccacaacgcgcgcact
gagcggcgcagggagaagtgccactgcgtcttccactggtgctgctacgtcagctgccaa
gagtgcgcgcgcgtctacgacgtgcacacctgcaagtag

DBGET integrated database retrieval system