KEGG   Tupaia chinensis (Chinese tree shrew): 102467892
Entry
102467892         CDS       T02978                                 

Gene name
ATP1B2
Definition
(RefSeq) ATPase Na+/K+ transporting subunit beta 2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102467892 (ATP1B2)
   04022 cGMP-PKG signaling pathway
    102467892 (ATP1B2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102467892 (ATP1B2)
   04918 Thyroid hormone synthesis
    102467892 (ATP1B2)
   04919 Thyroid hormone signaling pathway
    102467892 (ATP1B2)
   04925 Aldosterone synthesis and secretion
    102467892 (ATP1B2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102467892 (ATP1B2)
   04261 Adrenergic signaling in cardiomyocytes
    102467892 (ATP1B2)
  09154 Digestive system
   04970 Salivary secretion
    102467892 (ATP1B2)
   04971 Gastric acid secretion
    102467892 (ATP1B2)
   04972 Pancreatic secretion
    102467892 (ATP1B2)
   04976 Bile secretion
    102467892 (ATP1B2)
   04973 Carbohydrate digestion and absorption
    102467892 (ATP1B2)
   04974 Protein digestion and absorption
    102467892 (ATP1B2)
   04978 Mineral absorption
    102467892 (ATP1B2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102467892 (ATP1B2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102467892 (ATP1B2)
   04964 Proximal tubule bicarbonate reclamation
    102467892 (ATP1B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102467892 (ATP1B2)
CD molecules [BR:tup04090]
 Proteins
  102467892 (ATP1B2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 102467892
NCBI-ProteinID: XP_006151845
LinkDB
Position
Un
AA seq 290 aa
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVVVNISDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDPTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCVGKRDEDAENLGSFVMFPANGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcatccagaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgaggacgcaccagttcatgggccgaacggggaccagctgggcctttatc
ctcctcttctacctcgtcttctacggcttcctcacggccatgttctccctcaccatgtgg
gtgatgctgcagactgtctctgaccatacccccaaataccaggaccgactcgccacacca
ggcttgatgattcgccccaagactgagaaccttgatgttgttgtcaacatcagtgacact
gaaagctgggaccagcatgttcagaagctcaacaagttcttggaaccttacaacgactcc
atccaagcccagaagaatgatgtctgccgccctgggcgctattatgaacagcccgataac
ggtgtcctcaactaccctaaacgtgcctgccaattcaaccggacccagctaggcaactgc
tctggcatcggggaccccactcactatggttacagcactggacagccctgtgtcttcatc
aagatgaatcgagtcatcaacttctatgcaggagcaaaccagagcatgaatgttacctgt
gttggaaagcgagatgaagatgctgagaatcttggcagctttgtcatgttccctgccaac
ggcaacatcgacctcatgtacttcccttactacggcaaaaagttccacgtgaactacacg
cagcccctggtggccgtgaagttcctgaatgtgacccccaatgtggaggtgaatgtggaa
tgtcgcatcaacgccgccaacatcgccacggacgatgagcgagacaagttcgctggccgc
gtggccttcaaactccgcatcaacaaaacctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102474656
Entry
102474656         CDS       T02978                                 

Gene name
ATP1B4
Definition
(RefSeq) ATPase Na+/K+ transporting family member beta 4
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102474656 (ATP1B4)
   04022 cGMP-PKG signaling pathway
    102474656 (ATP1B4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102474656 (ATP1B4)
   04918 Thyroid hormone synthesis
    102474656 (ATP1B4)
   04919 Thyroid hormone signaling pathway
    102474656 (ATP1B4)
   04925 Aldosterone synthesis and secretion
    102474656 (ATP1B4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102474656 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    102474656 (ATP1B4)
  09154 Digestive system
   04970 Salivary secretion
    102474656 (ATP1B4)
   04971 Gastric acid secretion
    102474656 (ATP1B4)
   04972 Pancreatic secretion
    102474656 (ATP1B4)
   04976 Bile secretion
    102474656 (ATP1B4)
   04973 Carbohydrate digestion and absorption
    102474656 (ATP1B4)
   04974 Protein digestion and absorption
    102474656 (ATP1B4)
   04978 Mineral absorption
    102474656 (ATP1B4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102474656 (ATP1B4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102474656 (ATP1B4)
   04964 Proximal tubule bicarbonate reclamation
    102474656 (ATP1B4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102474656 (ATP1B4)
CD molecules [BR:tup04090]
 Proteins
  102474656 (ATP1B4)
SSDB
Motif
Pfam: Na_K-ATPase CDC45
Other DBs
NCBI-GeneID: 102474656
NCBI-ProteinID: XP_006165274
LinkDB
Position
Un
AA seq 356 aa
MRRQLRSRRALAFPYGYRYRLDDQDEVNQNYLADEEEEAEEEAQAVIVPDMEEEEEEEKE
GKEEEEKEEEEGQAQPTGNAWWQKLQIMNEYLWDSERRMSLARTGQSWSLILVMYFFFYA
SLAAVITLCMYMLFLTISPYIPTFTEQAKSPGVMIRPFAHSLNFNFNVSEPDTWQHYVIS
LNGFLQGYNDSLQEEMNVDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYS
TGQPCILLKMNRIVGFRPELGEPVKVSCKVQRGDENDIRSINYYPESASFDLRYYPYYGK
LTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIINDVINDRFVGRVIFTLNIET
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagaaggcagctccggtccagaagggctctggcctttccttacggttatcgctacaga
cttgatgaccaggatgaagtgaaccagaactacttagcagatgaagaggaggaagcagag
gaagaggcccaggcggtgatagttcctgatatggaggaggaagaagaggaagagaaagaa
gggaaggaagaggaggaaaaggaggaggaagagggtcaggctcaacccacaggcaatgcc
tggtggcagaaattgcagatcatgaatgaatacctgtgggattcggagagaaggatgtct
ctggcccgaacaggtcagagttggagcctgatcttggtcatgtatttcttcttctatgct
tccctggctgctgtgatcaccctctgcatgtacatgctatttctgaccatcagtccttac
ataccgaccttcactgagcaagcgaagtctcctggcgttatgatcagacccttcgcccat
agtcttaacttcaacttcaatgtttctgaacctgatacttggcagcattatgtgattagc
ctaaatggttttcttcagggttacaatgacagtcttcaagaggaaatgaatgtagattgc
cctccagggcagtatttcatccaagatggtgatgaggatgaggacaagaaggcttgccaa
tttaagcgctctttcttgaagaactgctctggtctggaggaccctacttttggatactca
actggacagccctgtatcctcctaaagatgaaccggattgtaggctttcgtcctgagctt
ggagagcctgtgaaggtttcctgcaaagttcagagaggtgatgaaaacgacatccgatcc
atcaattactacccagagtcggcttcttttgatctccgctactacccttactacggcaaa
ctaactcacgttaactacacctcccccctggtggcaatgcactttacagatgtggtgaag
aaccaagcggtgcccgtgcagtgccaactgaaaggcaaaggcatcataaatgatgtcatc
aatgatcgttttgtgggcagggtaatctttaccctgaacatagaaacctaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102475448
Entry
102475448         CDS       T02978                                 

Gene name
ATP1A3
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102475448 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    102475448 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102475448 (ATP1A3)
   04918 Thyroid hormone synthesis
    102475448 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    102475448 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    102475448 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102475448 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    102475448 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    102475448 (ATP1A3)
   04971 Gastric acid secretion
    102475448 (ATP1A3)
   04972 Pancreatic secretion
    102475448 (ATP1A3)
   04976 Bile secretion
    102475448 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    102475448 (ATP1A3)
   04974 Protein digestion and absorption
    102475448 (ATP1A3)
   04978 Mineral absorption
    102475448 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102475448 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102475448 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    102475448 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102475448 (ATP1A3)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     102475448 (ATP1A3)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102475448 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   102475448 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   102475448 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   102475448 (ATP1A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 102475448
NCBI-ProteinID: XP_014438012
LinkDB
Position
Un
AA seq 1067 aa
MASRKGAEKGGPKGQPETPEMQRCRGRAGHRGPVSPGTPSRPQSGGSDSYRVATSQDKKD
DKGSPKKSKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDG
PNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVL
AAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGG
DRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARG
VVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYT
WLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSD
KTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGG
QDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETE
DPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFC
HYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMV
TGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSE
QIDEVLQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI
AGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMA
NIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQ
IGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEF
TCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDV
ALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY
NT seq 3204 nt   +upstreamnt  +downstreamnt
atggcttccagaaagggggcggaaaagggaggcccgaagggacagcctgagaccccagag
atgcagagatgcagggggagagctgggcacagagggccggtgtcccctggaaccccttct
cgcccgcagtctggtggctctgacagctatcgtgtcgccacctcgcaggacaagaaagat
gacaagggctcgcccaagaagagcaagggcaaggagcgccgggacctggacgacctcaag
aaggaggtggcgatgacagagcacaagatgtccgtggaagaggtctgccggaaatacaac
acggactgcgtgcagggtctgacccacagcaaagcccaggagatcctggcccgggatggg
cctaacgcactcacgccaccgcccaccaccccggagtgggtcaagttctgccgacagctc
ttcgggggtttctccatcctattgtggattggggccatcctctgctttctggcctatggc
atccaggcgggcactgaggacgacccctctggggacaatctgtacctgggcatcgtgctg
gcggccgtggtcatcatcaccggctgcttctcctactaccaggaggccaagagctccaag
atcatggagtccttcaagaacatggtgccccagcaagccctggtgatccgggaaggcgag
aagatgcaggtgaacgcggaggaggtggtggtcggggatctggtggagatcaagggcgga
gatcgagtgcctgccgacctgcgaatcatctcagcccatggctgcaaggtggacaactcc
tccctgaccggtgagtccgagccgcagacgcgctcccctgactgcacgcatgacaacccc
ctggagacgcggaacatcaccttcttttccactaactgtgtggaaggcacagctcggggc
gtggtcgtggccacaggggaccgcactgtcatgggccgcatcgccaccctggcttcgggg
ctggaggtgggcaagacgcccattgctatcgagatcgagcacttcatccagctcatcacc
ggcgtggccgtcttcctgggcgtctccttcttcatcctctccctcatcctcggatatacc
tggctggaagctgtcatcttcctcatcggcatcatcgtggccaatgtcccagagggcctg
ctggccaccgtcactgtgtgcctgaccctgaccgccaagcgcatggcacggaagaactgc
ctggtcaagaacctggaggctgtagagaccctgggctccacgtccaccatctgctcggac
aagacagggaccctcactcagaaccgcatgacggtcgcccacatgtggtttgacaaccag
atccatgaggccgacaccaccgaagaccagtcagggacctcattcgacaagagctcacac
acctgggtggccctgtcccacatcgccggcctctgcaaccgcgccgtcttcaaaggcggt
caggacaacatccctgtgctcaagagagatgtggccggggatgcctccgagtctgccctg
ctcaagtgcatcgagttgtcctccggctccgtgaagctgatgcgcgagcgcaacaagaaa
gtggccgagattcccttcaactccaccaacaagtaccagctatccatccacgagaccgag
gaccccaacgacaaccgctacctgctggtgatgaagggcgcccccgagcgcatcctggac
cgctgctccaccatcctgctgcagggcaaggagcagccgctggacgaggagatgaaggag
gccttccagaacgcctacctggagctgggcggcctgggcgagcgcgtgctcggtttctgc
cattactacctgccggaggagcagttccccaagggctttgccttcgactgtgacgacgtg
aacttcaccacggacaacctctgcttcgtgggcctcatgtccatgatcgacccaccccgg
gcggccgtccctgacgccgtgggcaagtgccgcagcgcgggcatcaaggtcatcatggtc
acgggcgaccaccccatcacggccaaggccatcgccaagggcgtgggcatcatctccgag
ggcaatgagaccgtggaggacatcgctgcccggctcaacatccccgtcagccaggtcaac
ccccgggacgccaaggcctgtgtgatacacggcaccgacctcaaggacttcacctcggag
caaatcgacgaggttctgcagaaccacaccgagattgtctttgcccgcacgtccccccag
cagaagctcatcatagtggagggctgtcagagacagggtgcaattgtggccgtgacgggc
gatggcgtgaacgactcccctgccctgaagaaggccgacattggggtggccatgggcatc
gccggctccgacgtctccaagcaggccgcagacatgattctgctggatgacaactttgcc
tccatcgtcactggcgtggaagagggccgcctgatcttcgacaacctgaagaagtccatc
gcctacaccctgaccagcaacatccccgagatcacgcccttcctgctcttcatcatggcc
aacatcccgctgcccctgggcaccatcaccatcctctgcatcgacctgggcactgacatg
gtccctgccatctcactggcctacgaggcagctgagagcgacatcatgaagagacagccc
aggaacccacggacggacaagctggtcaacgagaggctcatcagcatggcctacgggcag
atcggaatgatccaggccctcggtggcttcttctcctactttgtgatcctggcagaaaat
ggcttcttacccggcaacctggtgggcatccggctgaactgggacgaccgcacggtcaac
gacctggaggacagttacgggcagcagtggacgtacgagcagaggaaggtggtggagttc
acgtgccacacggccttcttcgtgagcatcgtggtcgtgcagtgggccgacctgatcatc
tgcaagacgcggaggaactcggtcttccagcagggcatgaagaacaagatcttgatcttc
ggcctgtttgaagagacggccctggcagctttcctgtcctactgccccggcatggatgtg
gccctccgcatgtaccctctcaagcccagctggtggttctgtgccttcccctacagcttc
ctcatcttcgtctacgacgagatccgcaagctcatcctgcgcaggaaccccgggggttgg
gtggagaaagagacctactactga

KEGG   Tupaia chinensis (Chinese tree shrew): 102481090
Entry
102481090         CDS       T02978                                 

Gene name
ATP1B1
Definition
(RefSeq) ATPase Na+/K+ transporting subunit beta 1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102481090 (ATP1B1)
   04022 cGMP-PKG signaling pathway
    102481090 (ATP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102481090 (ATP1B1)
   04918 Thyroid hormone synthesis
    102481090 (ATP1B1)
   04919 Thyroid hormone signaling pathway
    102481090 (ATP1B1)
   04925 Aldosterone synthesis and secretion
    102481090 (ATP1B1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102481090 (ATP1B1)
   04261 Adrenergic signaling in cardiomyocytes
    102481090 (ATP1B1)
  09154 Digestive system
   04970 Salivary secretion
    102481090 (ATP1B1)
   04971 Gastric acid secretion
    102481090 (ATP1B1)
   04972 Pancreatic secretion
    102481090 (ATP1B1)
   04976 Bile secretion
    102481090 (ATP1B1)
   04973 Carbohydrate digestion and absorption
    102481090 (ATP1B1)
   04974 Protein digestion and absorption
    102481090 (ATP1B1)
   04978 Mineral absorption
    102481090 (ATP1B1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102481090 (ATP1B1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102481090 (ATP1B1)
   04964 Proximal tubule bicarbonate reclamation
    102481090 (ATP1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102481090 (ATP1B1)
CD molecules [BR:tup04090]
 Proteins
  102481090 (ATP1B1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 102481090
NCBI-ProteinID: XP_014442752
LinkDB
Position
Un
AA seq 303 aa
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISEFKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYEAYVLNIVRFLEKYKDSAQKDD
MIFEDCGNVPSDHKDRGEFNHEGGERKVCRFKLDWLGNCSGINDDSYGYKEGKPCIIIKL
NRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKDKVGSVEYFGLGGYAGFPL
QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEVRVECKAYGENIGYSEKDRFQGRFDVKIE
VKS
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcccgcggaaaagccaaggaggagggcagctggaagaaattcatctggaactcggag
aagaaggagtttctgggcaggaccggcggcagctggtttaagatcctgctgttctacgtg
atattttatggctgtctggctggcatcttcatcgggaccatccaggtgatgctgctcacc
atcagtgagttcaagcccacgtaccaggaccgcgtggccccaccaggattaacgcagatt
cctcagatccaaaagacggaaattgcctttcgtcctaatgaccccaagagctacgaggcg
tatgtgctaaacatagttcggttcctggaaaagtacaaagattcggcccagaaggatgac
atgattttcgaagactgtggcaacgtgcccagcgaccacaaagaccgaggagaatttaac
catgaaggaggagagcgaaaggtctgcaggttcaagcttgactggttgggaaattgctct
ggaataaacgatgacagttatggctacaaggagggcaaaccttgcatcatcataaagctc
aaccgagttctgggcttcaaaccgaagccacctaagaacgagtccttggagacatacccg
gtgatgaagtataacccctacgtcctgcctgttcagtgcactggcaagcgagacgaggac
aaggacaaagtggggagcgtggagtacttcggcctgggcggctacgccggcttccctctg
cagtactacccatactacggcaagctcctgcagcccaagtacctgcagcccctgctggcc
gtgcagttcaccaacctcaccatggacaccgaggtgcgcgtcgagtgtaaggcgtacggg
gagaacatcgggtacagtgagaaagaccgttttcagggacgctttgatgtaaagattgaa
gttaagagctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102481218
Entry
102481218         CDS       T02978                                 

Gene name
FXYD2
Definition
(RefSeq) FXYD domain containing ion transport regulator 2
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102481218 (FXYD2)
   04022 cGMP-PKG signaling pathway
    102481218 (FXYD2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102481218 (FXYD2)
   04918 Thyroid hormone synthesis
    102481218 (FXYD2)
   04919 Thyroid hormone signaling pathway
    102481218 (FXYD2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102481218 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    102481218 (FXYD2)
  09154 Digestive system
   04970 Salivary secretion
    102481218 (FXYD2)
   04972 Pancreatic secretion
    102481218 (FXYD2)
   04976 Bile secretion
    102481218 (FXYD2)
   04973 Carbohydrate digestion and absorption
    102481218 (FXYD2)
   04974 Protein digestion and absorption
    102481218 (FXYD2)
   04978 Mineral absorption
    102481218 (FXYD2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102481218 (FXYD2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102481218 (FXYD2)
   04964 Proximal tubule bicarbonate reclamation
    102481218 (FXYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102481218 (FXYD2)
   04147 Exosome [BR:tup04147]
    102481218 (FXYD2)
Transporters [BR:tup02000]
 Other transporters
  Pores ion channels [TC:1]
   102481218 (FXYD2)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102481218 (FXYD2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8
Other DBs
NCBI-GeneID: 102481218
NCBI-ProteinID: XP_006161936
LinkDB
Position
Un
AA seq 101 aa
MEDGAEAWRRECHSPSRPQAARSPQLSCTCGPSSSSAMDRWYLGGSPKGDVDPFYYDYET
VRNGGLIFAGLAFVVGLIIILSKRFRCGGAKKRRQVGEDEL
NT seq 306 nt   +upstreamnt  +downstreamnt
atggaggatggagctgaggcgtggaggagggagtgccactctccatccaggccccaggca
gcccgcagtccacagctctcctgcacctgcggacccagcagcagctctgccatggacagg
tggtacctgggtggcagccccaagggggatgtggacccattctactatgactacgagact
gtccgcaacgggggcctgatctttgctggcctggccttcgtcgtggggttgatcatcatc
ctcagcaaaaggttccgctgcggaggagcgaagaagcgccggcaagtgggtgaggatgag
ctgtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102483255
Entry
102483255         CDS       T02978                                 

Gene name
ATP1A2, ATP1A4
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102483255 (ATP1A2)
   04022 cGMP-PKG signaling pathway
    102483255 (ATP1A2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102483255 (ATP1A2)
   04918 Thyroid hormone synthesis
    102483255 (ATP1A2)
   04919 Thyroid hormone signaling pathway
    102483255 (ATP1A2)
   04925 Aldosterone synthesis and secretion
    102483255 (ATP1A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102483255 (ATP1A2)
   04261 Adrenergic signaling in cardiomyocytes
    102483255 (ATP1A2)
  09154 Digestive system
   04970 Salivary secretion
    102483255 (ATP1A2)
   04971 Gastric acid secretion
    102483255 (ATP1A2)
   04972 Pancreatic secretion
    102483255 (ATP1A2)
   04976 Bile secretion
    102483255 (ATP1A2)
   04973 Carbohydrate digestion and absorption
    102483255 (ATP1A2)
   04974 Protein digestion and absorption
    102483255 (ATP1A2)
   04978 Mineral absorption
    102483255 (ATP1A2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102483255 (ATP1A2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102483255 (ATP1A2)
   04964 Proximal tubule bicarbonate reclamation
    102483255 (ATP1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102483255 (ATP1A2)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     102483255 (ATP1A2)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102483255 (ATP1A2)
  Exosomal proteins of other body fluids (saliva and urine)
   102483255 (ATP1A2)
  Exosomal proteins of colorectal cancer cells
   102483255 (ATP1A2)
  Exosomal proteins of bladder cancer cells
   102483255 (ATP1A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Oxidored_nitro Sigma70_r4 HAD
Other DBs
NCBI-GeneID: 102483255
NCBI-ProteinID: XP_006168897
LinkDB
Position
Un
AA seq 1031 aa
MGFGRKRGSVSPHEPKPSPKSRRGTKTSNKKKTKQKKKKDMEELKKEVVMDDHKLTLEEL
SAKYSVDLTMGHSPEKAKEILLRDGPNTLTPPPTTPEWVKFCKQLFGGFSLLLWTGAILC
FLAYGIQVHFGQKPAKDNMYLGLVLAFVVIITGCFSYSQEAKSSRIMESFKNMVPQQALV
IRGGEKIQINAHEVVVGDLVDVKGGDRIPADLRIISSRGCKVDNSSLTGESEPQSRSPEF
THENPLETKNICFFSTNCVEGTARGVVIATGDLTVMGRIASLTSGLAVGQTPIAAEIEHF
IHLITMVAVFLGVSFFLLAILLGYTWLEAIIFLIGIIVANVPEGLLATVTVCLTLTAKRM
ARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVSHLWFDKTVYQADTTEEHSGKLF
GKGSDTWFVLARIAALCNQADFKAHQETVPIAKRVTTGDASESALLKFIEQFHSSVKEMR
EKNPKVAEIPFNSTNKYQLSIHLQEDSSQTHVLMMKGAPERILDFCSSFLLDGQEYPMDD
EMRKDFQNAYLELGGLGERVLGFCFLNLPSHFSKGFPFNTDEINFPVDNLCFVGLISMID
PPRAAVPDAVSKCRDAGIKVIMVTGDHPITAKAIARGVGIISEGSETVEDIATRLNISVS
QVSARSAKAIVVHGSQLKEMSSKQLDKILQNHKEIVFARTSPQQKLLIVEGCQRLGAIVA
VTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLK
KSIAYTLTSNIPEITPFLLFIILGIPLPLGTITILCIDLGTDMVPAISLAYEPAESDIMK
RQPRNAKIDNLVNHRLISMAYGQIGMIQAVAGFFTYFVILAENGFRPSELLGIRLRWDDL
FLNDLEDNYGQQWTFEQRKVVEFTCHTAFFVTIVVVQWSDLIICKTRRNSIFQQGLFRNK
ILLFGILEETLLAAFLSYCPGMDVALRMYPLKLNWWLCSIPYSIFIFTYDETRRFFIRHY
PGGWVERETYY
NT seq 3096 nt   +upstreamnt  +downstreamnt
atgggttttgggaggaagagagggtcagtgtctcctcatgagccgaaacctagcccaaaa
tccagaagagggaccaaaactagtaataaaaaaaagacgaagcagaagaaaaagaaagat
atggaggaactgaagaaggaagtggtcatggatgatcacaaactgaccttggaagagctg
agtgccaagtattctgtggacctgacaatgggccatagccctgaaaaggcaaaggaaatc
ctgcttcgagatgggccaaatacactcacgccaccccctactactccagaatgggtcaaa
ttctgtaaacaactgtttggtggcttctccctgttactatggacaggtgccatcctctgc
ttcttggcctatggcatccaggtgcatttcggtcagaaaccagccaaagataacatgtac
ctgggccttgtgctagcattcgtggtcatcattaccggctgcttctcctactctcaggaa
gccaagagctccaggatcatggagtcctttaagaacatggtgccacagcaagcgttggta
attcgaggcggagaaaagatacaaattaatgcccatgaagtggtcgtgggagacctggta
gatgtgaagggtggagacagaatccccgctgaccttcggattatctcttcacgagggtgt
aaggtggacaactcatccttgactggggagtcagagccccaatctcgctcccctgaattc
acccatgagaaccctctggagaccaaaaacatctgcttcttctctaccaactgtgtggaa
ggaacagcccggggtgttgtgattgctacaggagacttgacagtgatgggccgaatcgcc
tccctgacatcaggcctggcggtggggcagacacccatcgctgctgagatcgagcacttc
atccatctgatcacaatggtggccgtctttcttggtgtcagcttttttttgcttgcaatt
ctcttgggctacacctggctggaggctatcatttttcttattggcatcatcgtggccaat
gtgcctgaggggctgctggccactgtcactgtgtgcctgaccctaaccgccaagcgcatg
gcgcggaagaactgcctggtgaagaacctggaggcggtggagacgctgggctccacgtcc
accatctgctcggacaagacgggcaccctcacccagaaccgcatgaccgtctcccacctg
tggttcgataagaccgtgtatcaggccgacaccactgaagagcacagtgggaaattgttc
ggcaaaggatctgacacctggtttgttctggcccggatcgctgccctctgcaaccaggct
gacttcaaggcccatcaggagacagtgcctatagctaagcgggtgaccacaggcgatgca
tctgagtccgccctcctcaagttcatcgagcagtttcacagctctgtgaaggagatgaga
gagaagaaccccaaggtggcagagattccctttaattctaccaacaagtaccagctgtcc
atccacctccaggaggacagctctcaaacccacgtgctgatgatgaagggtgcccctgag
aggatcttggacttctgctcctctttccttctggacgggcaagagtacccgatggacgac
gagatgaggaaagacttccaaaatgcctacctagagctgggaggtctgggggagcgtgtg
ctagggttctgcttcttgaatctgcctagccacttctccaagggattcccctttaacacg
gatgaaatcaacttccccgtggacaacctctgctttgtgggcctcatatccatgatcgac
cctccccgtgctgcagtacctgatgctgtgagcaagtgccgagatgcagggatcaaggtg
atcatggtaacaggggatcaccccatcacggccaaggccattgccaggggtgtgggcatc
atctcagaaggctctgagacagtagaggacattgctacacggcttaatatctctgtcagc
caggtcagtgcgagatctgccaaagccattgtggtgcacggttcacagctgaaggaaatg
agctccaaacagctcgacaagatcctccagaaccacaaggagattgtgtttgctcggacc
tcccctcagcagaagctcctcattgtggaggggtgtcagcggctgggagccattgtggcg
gtgacgggcgacggtgtgaacgactccccggcgctgaagaaggccgacatcggcatcgcc
atgggcatctctggctcggacgtgtccaagcaggcagccgacatgatcctgctggacgac
aacttcgcctccatcgtcacgggcgtggaggagggccgcctgatctttgacaacctgaag
aagtccatcgcctacacgctgaccagcaacattccggagatcacccccttcctgctgttc
atcatccttggcatccctctgcctctgggcaccataaccatcctctgcattgacctgggg
actgacatggtccctgctatctccttggcttatgagccagccgaaagcgacataatgaag
aggcaaccccggaacgcaaagatagacaatctggtgaaccatcgtctcatcagcatggcc
tacggacagatcgggatgatccaggctgtggctggattcttcacctattttgtgatcctg
gctgagaatggttttagaccttctgaactgctgggcatccgcctcagatgggacgacctc
ttcctgaatgacctggaggacaactatgggcagcagtggaccttcgagcagcggaaggtg
gtggagttcacctgccacacggccttctttgtcaccatcgtggttgtgcagtggagtgac
ctcatcatctgcaagacccgccgcaactccatcttccagcagggcctctttagaaacaag
atcctgctgtttgggatcctggaggagacgctcctggctgcttttctgtcctactgccca
ggcatggacgtggccctgcgaatgtacccactcaagctaaactggtggctctgctccatt
ccctacagcatctttatcttcacttatgatgaaaccaggaggttcttcatccgtcactat
cctggtggctgggtggaaagggagacgtactactaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102483994
Entry
102483994         CDS       T02978                                 

Gene name
ATP1A1
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102483994 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    102483994 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102483994 (ATP1A1)
   04918 Thyroid hormone synthesis
    102483994 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    102483994 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    102483994 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102483994 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    102483994 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    102483994 (ATP1A1)
   04971 Gastric acid secretion
    102483994 (ATP1A1)
   04972 Pancreatic secretion
    102483994 (ATP1A1)
   04976 Bile secretion
    102483994 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    102483994 (ATP1A1)
   04974 Protein digestion and absorption
    102483994 (ATP1A1)
   04978 Mineral absorption
    102483994 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102483994 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102483994 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    102483994 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102483994 (ATP1A1)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     102483994 (ATP1A1)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102483994 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   102483994 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   102483994 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   102483994 (ATP1A1)
SSDB
Motif
Pfam: Cation_ATPase_C Hydrolase Cation_ATPase Hydrolase_3 DUF1290
Other DBs
NCBI-GeneID: 102483994
NCBI-ProteinID: XP_006161451
LinkDB
Position
Un
AA seq 554 aa
MRERYAKIVEIPFNSTNKYQLSIHKNLNTSEPRHLLVMKGAPERILDRCSSILLHGKEQP
LDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQYPEGFQFDTDDVNFPIDNLCFVGLI
SMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLN
IPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQG
AIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIF
DNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAES
DIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPIHLLGIRVD
WDDRWINDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGM
KNKILIFGLFEETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLII
RRRPGGWVEKETYY
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgagggagagatatgccaagatcgtcgagatccccttcaactccaccaacaagtaccag
ttgtccattcacaagaacctcaatacatctgagccccggcacctgctggtgatgaagggt
gccccagaaaggatcctagaccgttgcagctctatccttctccacggcaaggaacagccc
ctggatgaggagctgaaagatgccttccagaatgcctacctggagctgggtggccttgga
gaacgagtcctaggtttctgccaccttctcctgcccgacgagcagtaccctgaagggttc
cagtttgacacggatgatgtgaatttccctatcgataatctctgcttcgttgggctcatc
tctatgattgaccccccacgggctgctgttcccgacgccgtgggcaagtgtcgaagtgct
ggaattaaggtcatcatggtcacaggagaccatccgatcacagccaaagccattgccaaa
ggcgtgggcatcatctcagaaggcaatgagactgtggaagatatcgctgcccgcctcaac
atcccagtgagccaggtgaaccccagagatgcgaaggcctgcgtagtccacggcagtgac
ctgaaggacatgacctctgagcagctggatgacattttgaagtaccacaccgagatcgtg
tttgccaggacctctcctcagcagaagctcatcattgtggagggctgccagagacagggt
gctattgtggctgtgactggtgatggtgtaaatgactctccagctttgaagaaggcagac
attggggttgccatggggattgctggctcagatgtgtctaagcaagctgctgacatgatc
cttctggacgacaactttgcctccattgtgactggagtggaggaaggtcgtctgatcttt
gataacttgaagaaatccattgcttacaccctaactagtaacattccggagatcaccccc
ttcctgatatttattattgcaaacattccactaccactggggaccgtcaccatcctctgc
atcgacttgggcactgacatggttcctgccatctccctggcttatgagcaagctgagagt
gacatcatgaagagacagcccagaaatcccaaaacggacaaacttgtgaatgagcggctg
atcagtatggcctatggacagatcggtatgatccaggccctggggggcttcttcacttac
tttgtgattatggccgagaacggcttcctcccgattcacctgttgggcatccgagtggat
tgggacgaccgctggatcaatgacgtggaggacagctacgggcagcagtggacctacgag
cagaggaagatcgtggagttcacctgccacacagccttcttcgtcagtatcgtggtggtg
cagtgggctgacttggtcatctgtaagaccaggaggaattcagtcttccagcaggggatg
aagaacaagatcttaatatttggcctctttgaagagacggctcttgctgctttcctttcc
tactgccccggaatgggtgttgcccttaggatgtatcccctcaagcctacctggtggttc
tgtgccttcccctactctcttctcatctttgtgtatgacgaagtcagaaaactcatcatc
aggcgacgccctggcggctgggtggagaaggagacctactactag

KEGG   Tupaia chinensis (Chinese tree shrew): 102486693
Entry
102486693         CDS       T02978                                 

Gene name
ATP1B3
Definition
(RefSeq) ATPase Na+/K+ transporting subunit beta 3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102486693 (ATP1B3)
   04022 cGMP-PKG signaling pathway
    102486693 (ATP1B3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102486693 (ATP1B3)
   04918 Thyroid hormone synthesis
    102486693 (ATP1B3)
   04919 Thyroid hormone signaling pathway
    102486693 (ATP1B3)
   04925 Aldosterone synthesis and secretion
    102486693 (ATP1B3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102486693 (ATP1B3)
   04261 Adrenergic signaling in cardiomyocytes
    102486693 (ATP1B3)
  09154 Digestive system
   04970 Salivary secretion
    102486693 (ATP1B3)
   04971 Gastric acid secretion
    102486693 (ATP1B3)
   04972 Pancreatic secretion
    102486693 (ATP1B3)
   04976 Bile secretion
    102486693 (ATP1B3)
   04973 Carbohydrate digestion and absorption
    102486693 (ATP1B3)
   04974 Protein digestion and absorption
    102486693 (ATP1B3)
   04978 Mineral absorption
    102486693 (ATP1B3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102486693 (ATP1B3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102486693 (ATP1B3)
   04964 Proximal tubule bicarbonate reclamation
    102486693 (ATP1B3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102486693 (ATP1B3)
CD molecules [BR:tup04090]
 Proteins
  102486693 (ATP1B3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 102486693
NCBI-ProteinID: XP_006162378
LinkDB
Position
Un
AA seq 254 aa
MTPHAILQWNLGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLTVFP
KPVTALEYSFSMSNPKSYEGYIKDLKKFLEPYMAQEQKNVTGCRDGVLFEQKGPVYVACP
FPLTLLQPCSGTDDPNFGYPQGKPCVLVKMNRIIGLKPEGEPMIDCTAKGEYIPALNTYP
NLGVIDLKYFPYYGKKLHGGYLQPLVAVQLPFDHSGYGKEVTVECKVDGSSNLKNQDDRD
KFLGRVTFKVTVHA
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaccccgcacgcgatcctacagtggaatcttggtttgatcttgctcttctacctagtg
ttttatgggttcctggctgcacttttctcattcacaatgtgggttatgcttcagacgctg
aacgatgaggttccgaaataccgtgaccagatccctagtccaggacttacggtgtttcca
aaaccagtgaccgcgttggagtattcgttcagcatgtctaatccaaaatcctacgaaggg
tacatcaaagacctgaagaaatttctagagccatacatggcacaagagcagaagaatgtc
acaggctgtcgggacggagtgctgtttgaacagaagggcccagtgtacgtggcgtgtccg
tttcctcttacgctgcttcagccatgcagtggtacggacgaccctaattttggctatccc
caaggaaaaccctgtgtcctcgtgaaaatgaacagaatcattggattaaagcctgaagga
gaaccaatgatagactgtactgcaaagggtgaatacataccagctttaaacacctatcct
aatcttggagttatagacttaaaatattttccatattacgggaaaaaacttcacggcggg
tatctgcagccgctcgttgccgtccagctcccctttgatcacagcggctacggcaaagaa
gtgacagtggagtgcaaggtggacgggtcgtccaacctgaaaaaccaggatgatcgtgac
aagttcctgggacgagttacgttcaaagtcaccgtgcacgcatag

KEGG   Tupaia chinensis (Chinese tree shrew): 102493344
Entry
102493344         CDS       T02978                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-3-like
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04911  Insulin secretion
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04964  Proximal tubule bicarbonate reclamation
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup04974  Protein digestion and absorption
tup04976  Bile secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102493344
   04022 cGMP-PKG signaling pathway
    102493344
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102493344
   04918 Thyroid hormone synthesis
    102493344
   04919 Thyroid hormone signaling pathway
    102493344
   04925 Aldosterone synthesis and secretion
    102493344
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102493344
   04261 Adrenergic signaling in cardiomyocytes
    102493344
  09154 Digestive system
   04970 Salivary secretion
    102493344
   04971 Gastric acid secretion
    102493344
   04972 Pancreatic secretion
    102493344
   04976 Bile secretion
    102493344
   04973 Carbohydrate digestion and absorption
    102493344
   04974 Protein digestion and absorption
    102493344
   04978 Mineral absorption
    102493344
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102493344
   04961 Endocrine and other factor-regulated calcium reabsorption
    102493344
   04964 Proximal tubule bicarbonate reclamation
    102493344
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102493344
CD molecules [BR:tup04090]
 Proteins
  102493344
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 102493344
NCBI-ProteinID: XP_006162263
LinkDB
Position
Un
AA seq 278 aa
MTKKDKSSKQMLAKWKLFIYNRNTGEFLGRTAKSWSLILLFYLVFYGFLAALFSFTMWVM
LQTLNDEVPKYRDHVPSPGLTVFPKPETALDYSFSMSNPGSYKGYTEDLKKFLEPYTTQE
QKDVTGCRDGVLFEQEGPGYVACPFPLTLLQPCSGMNDSDFGYSQGNPCILVKMNRIIGL
KPEGEPRIDCTAKGEHTPALNTYPNLGVMDLKYFPYYGKKLHVGYLQPLVAVQVPFDHNS
YGKEVTVECKVNGSPNLKNQDDRDKFLGRVTFKVTVHA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgacgaagaaggacaagtcctccaagcagatgctggccaagtggaagctcttcatctac
aaccggaacaccggggagttcctggggcgcaccgccaagagctggagtttgatcctgctc
ttctacctagtgttttatgggttcctggccgcacttttctcattcacaatgtgggttatg
cttcagactctgaacgatgaggttccaaaataccgtgaccacgtccctagtccagggctt
acagtttttccaaaaccagagactgcactggactattcattcagcatgtctaacccaggt
tcctacaaagggtacactgaagaccttaagaagttcctagagccatatactacacaagag
cagaaggatgtcacaggctgtcgagacggagtgctttttgaacaggagggtccaggttat
gttgcatgtccgtttcctcttacgttacttcaaccatgcagtggtatgaatgattctgat
tttggctattcccaaggaaacccttgtattcttgtgaaaatgaacagaataattggatta
aagcctgaaggagaaccaaggatagactgtactgcgaagggggaacacacaccagcttta
aacacctaccctaatcttggagttatggacttaaagtattttccatattatgggaaaaaa
cttcatgtgggatatttacaaccactagttgctgtccaggtcccctttgatcacaacagc
tatggaaaagaagtaacagtcgagtgcaaggtcaacgggtcacccaacctgaaaaaccag
gatgatcgtgacaagttcctgggacgagttacgttcaaagtcaccgtgcatgcgtag

DBGET integrated database retrieval system